BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20879 (568 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ298995-1|CAC10056.1| 481|Drosophila melanogaster GPI1 protein... 29 3.3 AE014298-2377|AAN09397.2| 426|Drosophila melanogaster CG32578-P... 29 3.3 >AJ298995-1|CAC10056.1| 481|Drosophila melanogaster GPI1 protein protein. Length = 481 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -1 Query: 538 LIDF*QLLNLHSILFIFYFTLILYNPK*NINEIRSKVLKSNPYNI 404 L+D ++ LHS F Y T +LYN + + +V++ N YNI Sbjct: 326 LVDLISVIGLHSHCFYIY-TKVLYNVERRGLSVLWQVVRGNRYNI 369 >AE014298-2377|AAN09397.2| 426|Drosophila melanogaster CG32578-PA protein. Length = 426 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -1 Query: 538 LIDF*QLLNLHSILFIFYFTLILYNPK*NINEIRSKVLKSNPYNI 404 L+D ++ LHS F Y T +LYN + + +V++ N YNI Sbjct: 271 LVDLISVIGLHSHCFYIY-TKVLYNVERRGLSVLWQVVRGNRYNI 314 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,248,955 Number of Sequences: 53049 Number of extensions: 404881 Number of successful extensions: 806 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2213979693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -