BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20862 (321 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 1.6 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 3.7 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 20 6.4 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 20 8.4 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 20 8.4 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 22.2 bits (45), Expect = 1.6 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 70 LLRQQKYWWWRSVVQRWSEALGSS 141 L RQ ++R ++Q W ALG++ Sbjct: 338 LTRQNPAAFFRGMMQAWMTALGTA 361 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.0 bits (42), Expect = 3.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 130 EPRTISGRPIATTSISAVLVISLKFLVFEW 41 +P+ ISG P+A S++ V + F+ +W Sbjct: 581 QPQVISGNPVA--SVNMVGERAADFIKEDW 608 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 20.2 bits (40), Expect = 6.4 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -2 Query: 83 CCLSNFTQILSL*MAHCDSSV 21 C L+ T L +A C+S++ Sbjct: 166 CALTTLTDCLRSELAQCESNI 186 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 19.8 bits (39), Expect = 8.4 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = -3 Query: 169 IPQSITTAPGLIQEPRTISGRPIATTSISAVLVISLKFLVFEWHTV 32 I Q +TT G++ P R + S A I K + W T+ Sbjct: 218 IAQVVTTVAGIVSYPFDTVRRRMMMQSGRAKSEILYKSTLHCWATI 263 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 19.8 bits (39), Expect = 8.4 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = -3 Query: 169 IPQSITTAPGLIQEPRTISGRPIATTSISAVLVISLKFLVFEWHTV 32 I Q +TT G++ P R + S A I K + W T+ Sbjct: 218 IAQVVTTVAGIVSYPFDTVRRRMMMQSGRAKSEILYKSTLHCWATI 263 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,562 Number of Sequences: 438 Number of extensions: 1807 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6968808 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -