BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20857 (512 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 25 1.5 AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 25 2.0 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 24 2.6 AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 3.5 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 3.5 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 4.6 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 23 4.6 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 23 4.6 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 23 4.6 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 23 4.6 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 4.6 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 23 4.6 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 6.1 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 8.0 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 25.0 bits (52), Expect = 1.5 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 309 HHGSASGSEVVTELKSSIGTVSEVKPPYPRDDSAQY 202 + GSAS SE EL+ ++ + P +DD QY Sbjct: 79 YEGSASRSETERELQQALSGGNSQAVPKLQDDLLQY 114 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 401 YAASRDVWIDRLKASGSRLRC 463 YAA+ VW+DR K L C Sbjct: 25 YAAAEKVWVDRDKVYCGHLDC 45 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 24.2 bits (50), Expect = 2.6 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 386 METESAR-RAI*MSIHWFAGNGLSLVSTTG 300 +ETE+ +AI +HWFAG + V++ G Sbjct: 307 LETETRLYQAIVDMLHWFAGKQIRNVASVG 336 >AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 3.5 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P V AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKVVALRFNNAFVEEVQAG 41 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 3.5 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P V AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKVVALRFNNAFVEEVQAG 41 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 219 DDSAQYMMMPSVTGVAALIFSDIFMERDGGG 127 D AQY+ P + AL F++ F+E G Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAG 41 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.4 bits (48), Expect = 4.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 26 RCACPMSHTGKNCETK 73 RC+C S G CETK Sbjct: 46 RCSCDESFFGPFCETK 61 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.4 bits (48), Expect = 4.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 26 RCACPMSHTGKNCETK 73 RC+C S G CETK Sbjct: 46 RCSCDESFFGPFCETK 61 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.4 bits (48), Expect = 4.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 26 RCACPMSHTGKNCETK 73 RC+C S G CETK Sbjct: 46 RCSCDESFFGPFCETK 61 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 23.4 bits (48), Expect = 4.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 26 RCACPMSHTGKNCETK 73 RC+C S G CETK Sbjct: 46 RCSCDESFFGPFCETK 61 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 245 LTVPMEDLSSVTTSDPEALPWCLQVTG 325 + +P+ D V DPE LP +V G Sbjct: 5 IEIPLRDTDEVIELDPEQLPEGEEVLG 31 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 23.4 bits (48), Expect = 4.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 26 RCACPMSHTGKNCETK 73 RC+C S G CETK Sbjct: 622 RCSCDESFFGPFCETK 637 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 350 SIHWFAGNGLSLVSTTGVL 294 SI +F G GLSL ++ GV+ Sbjct: 2784 SIAYFVGMGLSLSASIGVM 2802 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 22.6 bits (46), Expect = 8.0 Identities = 16/54 (29%), Positives = 20/54 (37%) Frame = -3 Query: 249 VSEVKPPYPRDDSAQYMMMPSVTGVAALIFSDIFMERDGGGALIARNALPVKAG 88 +SEV PP M+PSV +I +E LI PV G Sbjct: 476 LSEVVPPLSLPPPLTGAMLPSVQSAETVILPSGVLETPFDVQLIPSVGAPVSNG 529 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 554,318 Number of Sequences: 2352 Number of extensions: 10637 Number of successful extensions: 71 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -