BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20852 (378 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 21 4.8 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 4.8 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 4.8 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 6.4 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 21.0 bits (42), Expect = 4.8 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 50 RLFCLCTLEHINIL 91 +L+C C L++ NIL Sbjct: 60 QLYCECILKNFNIL 73 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 4.8 Identities = 9/22 (40%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +2 Query: 26 QTCAGNCKRLFCLCTLE-HINI 88 Q C+GNCK L T+ H+ + Sbjct: 240 QVCSGNCKLNDILLTVRPHLEL 261 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 4.8 Identities = 9/22 (40%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +2 Query: 26 QTCAGNCKRLFCLCTLE-HINI 88 Q C+GNCK L T+ H+ + Sbjct: 240 QVCSGNCKLNDILLTVRPHLEL 261 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 20.6 bits (41), Expect = 6.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 188 ILYTGLFINNEWVKSXDGKTFKMKTLPMAK 277 +L +GL NN+ + S TF +KT + K Sbjct: 143 VLDSGLVNNNQPMCSPKLLTFDLKTSKLVK 172 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,261 Number of Sequences: 438 Number of extensions: 2145 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9176370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -