BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20845 (717 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5CU26 Cluster: Large low complexity protein; n=2; Cryp... 33 9.3 >UniRef50_Q5CU26 Cluster: Large low complexity protein; n=2; Cryptosporidium|Rep: Large low complexity protein - Cryptosporidium parvum Iowa II Length = 2338 Score = 32.7 bits (71), Expect = 9.3 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 1/86 (1%) Frame = +2 Query: 458 PDRSHIMRL-CYICRERAYQSITKAGIRHNLKLITYKIICFAAS*LQITILKLVSIYKHE 634 P++SH Y+C + + I ++ IT I LQ ++ L+S K + Sbjct: 1798 PEKSHDTGTKSYLCSIKNNNDYLSSSINGEIRFIT-TIQNIGMEALQFYMMSLLSFDKVD 1856 Query: 635 ICNTKKIKHVPILSKSRLKIIIDTTV 712 I N K+I H L +K ++DT V Sbjct: 1857 ISNLKEISHQNFLIPLVIKKLLDTLV 1882 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,872,193 Number of Sequences: 1657284 Number of extensions: 12781730 Number of successful extensions: 25470 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 24774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25469 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 57851245060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -