BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20845 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC713.07c |||vacuolar polyphosphatase |Schizosaccharomyces pom... 26 4.7 SPBC16A3.16 |||mitochondrial inner membrane protein involved in ... 25 8.2 >SPBC713.07c |||vacuolar polyphosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 577 Score = 26.2 bits (55), Expect = 4.7 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +1 Query: 52 FLYT*VYLESFHD--LSYKLIYKYKNSSYNI 138 FL T Y+++ D +SY+L+Y K+S YN+ Sbjct: 479 FLNTSNYMDATKDTEISYELLYTSKDSPYNM 509 >SPBC16A3.16 |||mitochondrial inner membrane protein involved in cytochrome c oxidase assembly Pet191 |Schizosaccharomyces pombe|chr 2|||Manual Length = 85 Score = 25.4 bits (53), Expect = 8.2 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 483 RRMMCDLSGKYRHAPGGNPERIPTNPTN 400 +R M D++ +YR AP N ++ P+N Sbjct: 54 KRQMLDMTKRYRIAPEKNTDQDTEKPSN 81 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,852,021 Number of Sequences: 5004 Number of extensions: 56787 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -