BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20845 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.0 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 6.7 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 8.8 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 434 PPGACRYLPDRSHIMRLCYI 493 PPG + PDR ++ C I Sbjct: 650 PPGTRFFYPDRKQVILKCNI 669 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 434 PPGACRYLPDRSHIMRLCYI 493 PPG + PDR ++ C I Sbjct: 740 PPGTRFFYPDRKQVILKCNI 759 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -2 Query: 407 PQTVGTLTHRLSCSKVRVRKILKECKICAADFKMSRI 297 PQ L + C++ + ILKE KI K + Sbjct: 475 PQVETILQNACFCARNELMMILKEIKIITDQLKSEEL 511 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 114 IQKLFLQYKITMNLKRRKK 170 I+K+FL+Y T+ + RR K Sbjct: 334 IRKIFLKYLPTILMMRRPK 352 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,864 Number of Sequences: 438 Number of extensions: 4190 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -