BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20839X (302 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0268 - 19574540-19574582,19574664-19574755,19574843-195749... 30 0.30 05_03_0076 + 8164466-8164511,8164643-8164698,8165529-8165867,816... 27 2.1 03_02_0829 - 11599665-11600364,11600853-11601076,11601786-116020... 27 2.1 12_02_0161 + 14659338-14659467,14659553-14659888,14660034-146602... 27 2.8 12_01_1022 - 10435409-10435564,10435950-10436219,10436820-104371... 26 4.9 10_08_0888 - 21317163-21317687,21318044-21318153,21318258-21318408 26 4.9 08_02_0630 - 19483485-19483671,19483761-19484179,19485180-194854... 26 4.9 06_01_0041 + 403634-403817,404154-404332,404431-404536,404620-40... 26 4.9 06_03_1358 - 29548440-29549315 26 6.5 05_03_0130 - 8770354-8770678,8770799-8770992,8771091-8771203,877... 26 6.5 05_02_0097 - 6573093-6573254,6573297-6573398,6573922-6574005,657... 26 6.5 02_02_0200 - 7718760-7718816,7718910-7719011,7719643-7719726,771... 26 6.5 08_02_0949 - 22920363-22920685,22922621-22922824,22923170-229232... 25 8.6 05_01_0131 + 888247-888771,889092-889154 25 8.6 03_05_1105 + 30438140-30438350,30438448-30438926 25 8.6 03_01_0173 + 1407891-1408097,1409746-1410123 25 8.6 >05_04_0268 - 19574540-19574582,19574664-19574755,19574843-19574920, 19575095-19575232,19575478-19575606,19575889-19576018, 19576171-19576348,19576715-19576853,19577031-19577120, 19577260-19577421,19577556-19577720,19577909-19578046, 19578657-19578836,19579129-19579257,19579442-19579677, 19579795-19579957,19580030-19580070,19580162-19580489, 19581416-19581553,19581670-19581873 Length = 966 Score = 30.3 bits (65), Expect = 0.30 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +2 Query: 140 SRSASKFAANFQNGPQNGAXPVVHTPSNPDDMSSSLLRTIPTGTRQVTS 286 +RS A + + GP G VV TP P+ ++SLL IP R +TS Sbjct: 136 NRSVGHLAPD-RTGPVAGVE-VVRTPLRPEPSTTSLLLPIPAMVRLITS 182 >05_03_0076 + 8164466-8164511,8164643-8164698,8165529-8165867, 8165938-8166012,8166674-8166846,8168697-8168795, 8169002-8169161,8169321-8169464,8169551-8169723, 8169796-8169991,8170061-8170258,8170864-8171016, 8171838-8171959,8172037-8172136,8172221-8172316, 8172400-8172530,8173717-8173819,8174373-8174555, 8174632-8174724,8174818-8174853,8175672-8175773, 8176310-8176472,8176557-8176678,8176994-8177158, 8177667-8177849,8178679-8178831,8179136-8179288, 8179373-8179444,8179530-8179664,8179739-8179800, 8179999-8180096,8180628-8180737,8180832-8181005, 8181092-8181157,8181847-8181915,8181989-8182099, 8182418-8182558,8182638-8182766,8182864-8183029, 8183174-8183388,8184883-8185089,8185501-8185572, 8185897-8186010,8186090-8186281,8186489-8186569, 8186654-8186728,8186812-8186878,8187292-8187452, 8187943-8188116,8188209-8188337,8188421-8188504, 8188589-8188650,8188728-8188800,8189008-8189142, 8189790-8189960,8190054-8190319,8190440-8190458 Length = 2448 Score = 27.5 bits (58), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -3 Query: 264 VGIVLRRLELMSSGFEGVCTT--GWAPFW 184 V + ++RL L ++ E +C GW PFW Sbjct: 2420 VKVQVQRLILQATSHENLCQNYVGWCPFW 2448 >03_02_0829 - 11599665-11600364,11600853-11601076,11601786-11602000, 11602300-11602377,11602593-11603907 Length = 843 Score = 27.5 bits (58), Expect = 2.1 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 128 SSTGSRSASKFAANF-QNGPQNGAXPVVHTPSNPDDMSSSL 247 SS S++K ++F +NG NG +H S+ D+ SSL Sbjct: 761 SSLSRSSSTKTISSFSRNGELNGEMSEIHRNSHTTDLQSSL 801 >12_02_0161 + 14659338-14659467,14659553-14659888,14660034-14660266, 14660344-14660805,14660887-14661719,14661802-14661972, 14662052-14662352 Length = 821 Score = 27.1 bits (57), Expect = 2.8 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 126 PPAPDRGVQANSLPISKMAPRTVPXP 203 PP P RG A S+P+SK A + V P Sbjct: 555 PPEPKRGKTATSMPVSK-AGKVVRAP 579 >12_01_1022 - 10435409-10435564,10435950-10436219,10436820-10437125, 10437932-10438057,10439825-10439893,10440443-10440487, 10440717-10440776,10441527-10441589,10442186-10442266, 10442494-10442916 Length = 532 Score = 26.2 bits (55), Expect = 4.9 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 244 PPENDPDRNPSGNINPS 294 PP++DP P G+I+PS Sbjct: 9 PPKSDPGATPIGSISPS 25 >10_08_0888 - 21317163-21317687,21318044-21318153,21318258-21318408 Length = 261 Score = 26.2 bits (55), Expect = 4.9 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = -3 Query: 246 RLELMSSGFEGVCTTGWAPF---WGPFWKLAAN 157 +L++M S G T W P WG W+L AN Sbjct: 187 QLDVMESLPSGKPTRVWTPMRRSWGSIWRLDAN 219 >08_02_0630 - 19483485-19483671,19483761-19484179,19485180-19485413, 19485714-19485851 Length = 325 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +1 Query: 145 ECKQIRCQFPKWPPERCPXRXAYAFEPXRHELQPPENDPDRNPSGNINPS 294 EC+Q +W +R A P QPP + PD +G+ NP+ Sbjct: 273 ECRQQHITHEEWKEKRALAIATAAAAPP----QPPPSMPDPTAAGSDNPA 318 >06_01_0041 + 403634-403817,404154-404332,404431-404536,404620-404936, 405231-405605,406199-406283,406570-408066,408575-408738 Length = 968 Score = 26.2 bits (55), Expect = 4.9 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 191 GAXPVVHTPSNPDDMSSSLLRTIPTGTRQVTSTHP 295 G + H P D +LL PT V STHP Sbjct: 439 GQESIAHGPPLSDGAVQNLLPISPTHKLDVASTHP 473 >06_03_1358 - 29548440-29549315 Length = 291 Score = 25.8 bits (54), Expect = 6.5 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +1 Query: 121 ASLQHRIAECKQI-RCQFPKWPPERCPXRXAYAFEPXRHELQPPENDPDRNP 273 +SL+ R + K + P PP + R A A P H PP PD P Sbjct: 47 SSLESRFRKLKSLPAAPLPPPPPAKSLGRSATA--PPHHTDPPPSETPDPAP 96 >05_03_0130 - 8770354-8770678,8770799-8770992,8771091-8771203, 8771320-8771482 Length = 264 Score = 25.8 bits (54), Expect = 6.5 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -3 Query: 252 LRRLELMSSGFEGVCTTGWAPFWGPFWKLAANLLALRDPV 133 L ++LM +G G T WG WKL+A AL+ P+ Sbjct: 193 LSGMDLMQTG-AGAAWTPMQQSWGAVWKLSAG-AALQAPL 230 >05_02_0097 - 6573093-6573254,6573297-6573398,6573922-6574005, 6574190-6574285,6574373-6574423,6574537-6574677, 6575025-6575081,6575163-6575237,6575323-6575595, 6575689-6575748,6576184-6576285,6576377-6576451 Length = 425 Score = 25.8 bits (54), Expect = 6.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 151 KQIRCQFPKWPPERCPXRXAYAFEPXRHELQPPE 252 ++IRC P + R P A+ + H+ PPE Sbjct: 286 EEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPE 319 >02_02_0200 - 7718760-7718816,7718910-7719011,7719643-7719726, 7719821-7719916,7720016-7720066,7720162-7720302, 7720717-7720773,7720864-7720938,7721033-7721305, 7721382-7721441,7721531-7721620,7722519-7722638 Length = 401 Score = 25.8 bits (54), Expect = 6.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 151 KQIRCQFPKWPPERCPXRXAYAFEPXRHELQPPE 252 ++IRC P + R P A+ + H+ PPE Sbjct: 297 EEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPE 330 >08_02_0949 - 22920363-22920685,22922621-22922824,22923170-22923263, 22923376-22923470,22923612-22923783 Length = 295 Score = 25.4 bits (53), Expect = 8.6 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 160 EFACTPRSGAGG 125 EFAC PR+ AGG Sbjct: 253 EFACAPRAAAGG 264 >05_01_0131 + 888247-888771,889092-889154 Length = 195 Score = 25.4 bits (53), Expect = 8.6 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = +2 Query: 191 GAXPVVHTPSNPDDMSS----SLLRTIPTGTRQVTSTHP 295 G P+ P P S+ S+LR +PTG +TS P Sbjct: 71 GPDPITSDPPPPPPPSTPTQFSVLRKVPTGPDPITSDPP 109 >03_05_1105 + 30438140-30438350,30438448-30438926 Length = 229 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 4 IFLGIIPSVLLVMFLVYYSRHNV 72 IFL I+P ++L YY RH V Sbjct: 62 IFLIILPFIVLCPLYYYYQRHPV 84 >03_01_0173 + 1407891-1408097,1409746-1410123 Length = 194 Score = 25.4 bits (53), Expect = 8.6 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 157 IRCQFPKWPPERCPXRXAYA 216 +RC++ +WPP+ R A+A Sbjct: 15 LRCRWREWPPQPSVSRIAFA 34 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,327,471 Number of Sequences: 37544 Number of extensions: 126810 Number of successful extensions: 443 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 351703996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -