BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20838 (453 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0866 - 6765761-6766413,6766805-6766906,6767693-6768965 29 1.3 04_03_0314 - 14238620-14240128 29 2.3 12_02_0847 + 23630937-23631099,23631200-23631396,23631604-236317... 27 9.3 >01_01_0866 - 6765761-6766413,6766805-6766906,6767693-6768965 Length = 675 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = -3 Query: 196 GEDKSELNWETIPDDVLGALEPKLIGVLHAVHLVVSYQFVH 74 GED++ LNWET LGA G+ H +H + +FVH Sbjct: 462 GEDRTPLNWETRVRIALGAAR----GIAH-IHTENNGKFVH 497 >04_03_0314 - 14238620-14240128 Length = 502 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +2 Query: 167 FPVEFRLIFAENAIKLMYKRDGLALTLSNVFKATMADLPTADGKDKTSPRVXWKL 331 +P FRL A + L LA+ L+ +A ADL G + +PR+ K+ Sbjct: 132 YPALFRLFQAPTSHPLSPNLSTLAVALTPAAEALAADLAALRGSSELAPRLAAKM 186 >12_02_0847 + 23630937-23631099,23631200-23631396,23631604-23631738, 23631904-23632077,23632195-23632407,23632507-23632751, 23632890-23632930,23633200-23633238,23633552-23633565 Length = 406 Score = 26.6 bits (56), Expect = 9.3 Identities = 14/55 (25%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +2 Query: 8 DSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLW--LQGSKDIVRDC 166 D +++ K Y E + + N + ++ N + AY+LW G K +R+C Sbjct: 301 DEKLQELKRDYGEGAHKAVMNALMEMKEYNVLADRSIAYELWNYKDGRKATLREC 355 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,452,602 Number of Sequences: 37544 Number of extensions: 209548 Number of successful extensions: 592 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 592 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 883560296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -