BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20838 (453 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB158503-1|BAD69710.1| 151|Homo sapiens splice variant of four ... 31 2.4 AK000943-1|BAA91437.1| 530|Homo sapiens protein ( Homo sapiens ... 29 7.4 >AB158503-1|BAD69710.1| 151|Homo sapiens splice variant of four and a half LIM domain protein 2 protein. Length = 151 Score = 30.7 bits (66), Expect = 2.4 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 111 WSTPINFGSRAPRTSSGIVSQLSSDLSSPKT-RLSLC 218 WST G R +++ SQL +SSPKT R+S+C Sbjct: 57 WSTRAAAGMRPASSATAASSQLEPRVSSPKTIRISVC 93 >AK000943-1|BAA91437.1| 530|Homo sapiens protein ( Homo sapiens cDNA FLJ10081 fis, clone HEMBA1002018. ). Length = 530 Score = 29.1 bits (62), Expect = 7.4 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +3 Query: 141 APRTSSGIVSQLSSDLSSPKTRLSLCTSATVS 236 +P S G+ S SS SSPKT+++ TSA S Sbjct: 436 SPSGSEGLSSVSSSPTSSPKTKVTTVTSAQKS 467 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,246,333 Number of Sequences: 237096 Number of extensions: 1133397 Number of successful extensions: 3056 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3056 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3758237868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -