BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20837 (338 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC736.05 |wtf7||wtf element Wtf7|Schizosaccharomyces pombe|chr... 31 0.036 SPAC1687.04 |||conserved eukaryotic protein|Schizosaccharomyces ... 24 5.5 SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa... 23 9.6 SPAC343.02 |img1||mitochondrial ribosomal protein subunit L19|Sc... 23 9.6 SPAC637.09 |||ribonuclease H70 |Schizosaccharomyces pombe|chr 1|... 23 9.6 SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2... 23 9.6 SPBC32H8.09 |||WD repeat protein, human WDR8 family|Schizosaccha... 23 9.6 >SPCC736.05 |wtf7||wtf element Wtf7|Schizosaccharomyces pombe|chr 3|||Manual Length = 220 Score = 31.5 bits (68), Expect = 0.036 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -2 Query: 289 NLHXNSDHQVQLEE*LAMKCQVGNGSQQPTIAQLSLLDVEATVAFD 152 ++H +D+++ LE+ L KC GNG P ++ D +A V D Sbjct: 16 SVHSGNDNEIDLEKGLLPKCNTGNGGTTP-CSEPPHYDSDAVVEMD 60 >SPAC1687.04 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 501 Score = 24.2 bits (50), Expect = 5.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +1 Query: 208 VGCRCQLDTSSQVILPVVPDDQSFXEDYAGVFH 306 VGCRC+ D+ + P D+ +++ FH Sbjct: 400 VGCRCRGDSPDTIEFPTDSDE---LQEFCNFFH 429 >SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 23.4 bits (48), Expect = 9.6 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 105 SLGSDLGKSATTLNCSSKATVASTSNKE 188 SL S+LGK+ T SKA V ++++ E Sbjct: 473 SLSSNLGKTNPTSVYQSKANVTTSADVE 500 >SPAC343.02 |img1||mitochondrial ribosomal protein subunit L19|Schizosaccharomyces pombe|chr 1|||Manual Length = 182 Score = 23.4 bits (48), Expect = 9.6 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 190 LSLLDVEATVAFDEQLRVVADFPRSEPSDGPVQALLVVEA 71 LSL + + DEQ F RS+P+ A+L+VE+ Sbjct: 44 LSLFEKKCRSVLDEQSERFKMFHRSQPNRVRPGAVLLVES 83 >SPAC637.09 |||ribonuclease H70 |Schizosaccharomyces pombe|chr 1|||Manual Length = 623 Score = 23.4 bits (48), Expect = 9.6 Identities = 9/32 (28%), Positives = 21/32 (65%) Frame = -2 Query: 244 LAMKCQVGNGSQQPTIAQLSLLDVEATVAFDE 149 LA+ C++ IA+++++D+++ V +DE Sbjct: 269 LAIDCEMVRTENGLEIARVTIVDMKSEVIYDE 300 >SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 23.4 bits (48), Expect = 9.6 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 65 DRSLYYKESLDRPITWLRPGEISDNP-QLFVEGYSRFDVQQGELGDCW 205 D + + D P+ + G+ ++P + V Y+ FDVQ L D W Sbjct: 62 DIGYHQMDGQDVPLPPIVLGQYGNDPSKKTVLIYNHFDVQPASLEDGW 109 >SPBC32H8.09 |||WD repeat protein, human WDR8 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 483 Score = 23.4 bits (48), Expect = 9.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 104 ITWLRPGEISDNPQLFVEGYSRFDV 178 + WL+P E S P + + G + V Sbjct: 421 VQWLQPSEFSSRPVIVICGEDAYTV 445 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,362,299 Number of Sequences: 5004 Number of extensions: 23797 Number of successful extensions: 68 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 98026656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -