BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20834 (771 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 28 0.095 DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 27 0.13 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 22 4.7 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 8.2 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 27.9 bits (59), Expect = 0.095 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 67 ALRSICTKCQRNSLERIAKL*QLDSAKKMLNWKKIKKQ 180 AL S CTKC + E K+ + + K+ +W+++ K+ Sbjct: 69 ALSSGCTKCNQKQKETAEKVIRHLTQKRARDWERLSKK 106 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 27.5 bits (58), Expect = 0.13 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +1 Query: 25 CTSHID*LVFI*YLALRSICTKCQRNSLERIAKL*QLDSAKKMLNWKKI 171 CT D L + AL+S C KC E K+ S K WK++ Sbjct: 51 CTPDADELKRVLPDALKSDCAKCSEKQKEMTKKVIHFLSHNKQQMWKEL 99 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +1 Query: 67 ALRSICTKCQRNSLERIAKL*QLDSAKKMLNWKKIKKQ 180 AL++ C KC E I K+ +K W++++K+ Sbjct: 65 ALKNECAKCNDKHKEGIRKVIHYLVKQKPEWWEQLQKK 102 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.4 bits (43), Expect = 8.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 111 ENSKAVAARQRKENAKLEKDQKTKKAVEDAEWEDNDD 221 E S A ++KE +KD K K +ED ++++D Sbjct: 222 ELSDDEAEEEKKEEEGEDKD-KDKPKIEDVGEDEDED 257 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,844 Number of Sequences: 336 Number of extensions: 2347 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -