BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20834 (771 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 2.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 2.4 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 3.1 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 5.5 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 639 FAQASQLKGTAKERMAQITTEPPQ 710 F QAS L G ++ + + EPPQ Sbjct: 886 FCQASNLYGRDQQLVQLLVQEPPQ 909 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 639 FAQASQLKGTAKERMAQITTEPPQ 710 F QAS L G ++ + + EPPQ Sbjct: 882 FCQASNLYGRDQQLVQLLVQEPPQ 905 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 437 SKVVIEEPPLEENLNRIQLDGELARLLMK 523 + + ++EPPL +NLN + L L L K Sbjct: 239 ANISLDEPPLGKNLN-LSLHASLNHTLTK 266 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -1 Query: 597 GCEGCFKSFFRMSIYFRLITEYRESFINSLANSPSN 490 GC F + +Y + +YR +F + SPSN Sbjct: 302 GCLYYFSTTINPILYNVMSAKYRNAFKETCRCSPSN 337 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,590 Number of Sequences: 438 Number of extensions: 2519 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -