BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20831 (618 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC354.12 |gpd3||glyceraldehyde 3-phosphate dehydrogenase Gpd3|... 26 3.8 SPCC622.11 |||LMBR1-like membrane protein|Schizosaccharomyces po... 26 5.0 SPAP27G11.12 |||human down-regulated in multiple cancers-1 homol... 25 6.6 SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizos... 25 8.8 >SPBC354.12 |gpd3||glyceraldehyde 3-phosphate dehydrogenase Gpd3|Schizosaccharomyces pombe|chr 2|||Manual Length = 335 Score = 26.2 bits (55), Expect = 3.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 111 VDVHGLR*PLNTKWSVSSS 167 +DVH R P N KWS S + Sbjct: 74 IDVHNERDPANIKWSASGA 92 >SPCC622.11 |||LMBR1-like membrane protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 562 Score = 25.8 bits (54), Expect = 5.0 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 27 TIISIVRLLYCKTVT*ISGLKVRCGIYVVDVHGLR*PLNTKWSVSSS 167 T+I I + + ++ I G+ V G+YV V L P++ W VS S Sbjct: 72 TLIWIYKYIEPHSLISIPGIFVFLGLYVPFVVTLLIPIDVTWDVSLS 118 >SPAP27G11.12 |||human down-regulated in multiple cancers-1 homolog 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 797 Score = 25.4 bits (53), Expect = 6.6 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = +2 Query: 203 RSHTPFPLHPVYSLLFLTLNYVQVTNTIEI----NKHFTNSSL*AYLDSQSIE 349 RS +P P +P+ S F N VT+ EI +K ++SL + DS+ ++ Sbjct: 591 RSKSPTPYYPIESSEFGFTNLKDVTSKDEITDGFDKALRSNSLRTHRDSRPVQ 643 >SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1338 Score = 25.0 bits (52), Expect = 8.8 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 141 NTKWSVSSSTT*AIKIVGIKVEAIPRSLCTLYTACYSLHSIMYKLP 278 N+ SVS T + ++G + + LC L T+ Y H+ + LP Sbjct: 163 NSLGSVSPLVTKLLDVIGFGASLLDKYLCDLRTS-YHKHNSLDALP 207 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,289,259 Number of Sequences: 5004 Number of extensions: 42982 Number of successful extensions: 78 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -