BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20826 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 9.9 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 9.9 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 22.6 bits (46), Expect = 9.9 Identities = 11/28 (39%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +3 Query: 84 LPHY---RHWLWPNLNFIKKKKTFTILE 158 LPH R W WP+LN + K + E Sbjct: 83 LPHVICCRLWRWPDLNSHTELKPLDVCE 110 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 22.6 bits (46), Expect = 9.9 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +3 Query: 135 KKTFTILEVRRTKVASLDFMVRKEETWGVIMNVLTTWIHLSKTFERRDLTS 287 +KT EVR T SLD + E+ IM IHL+ + R+ S Sbjct: 216 QKTQMFPEVRSTNAYSLDEIQTWYESLAAIMWNTKDQIHLTMKSQLREHVS 266 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 579,727 Number of Sequences: 2352 Number of extensions: 10684 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -