BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20826 (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83227-3|CAB05726.2| 241|Caenorhabditis elegans Hypothetical pr... 29 2.5 Z99273-1|CAB16477.1| 645|Caenorhabditis elegans Hypothetical pr... 27 7.7 Z66495-5|CAA91272.1| 501|Caenorhabditis elegans Hypothetical pr... 27 7.7 >Z83227-3|CAB05726.2| 241|Caenorhabditis elegans Hypothetical protein F45B8.3 protein. Length = 241 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 311 PSSPNSPSTCEIAPLKCL*QVNPCCEHVHNYPPC 210 P P++P+ C AP+ NPCC+ PC Sbjct: 154 PPPPSAPACCVAAPVP----TNPCCQPAPRPAPC 183 >Z99273-1|CAB16477.1| 645|Caenorhabditis elegans Hypothetical protein Y45F10C.1 protein. Length = 645 Score = 27.5 bits (58), Expect = 7.7 Identities = 19/47 (40%), Positives = 21/47 (44%) Frame = +1 Query: 307 EGSKTRTGSVYTAANSAGFYGSGNYDLSNLRGRNFQEGTS*IMRTPH 447 EG K + T ANS SGNY + R R EG S TPH Sbjct: 365 EGRKRAWKTRATGANSGNTGSSGNY---SKRSRRDGEGCSSRQETPH 408 >Z66495-5|CAA91272.1| 501|Caenorhabditis elegans Hypothetical protein C36A4.6 protein. Length = 501 Score = 27.5 bits (58), Expect = 7.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 99 HWLWPNLNFIKKK 137 HWLW NLN IK + Sbjct: 42 HWLWGNLNIIKDR 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,788,787 Number of Sequences: 27780 Number of extensions: 260997 Number of successful extensions: 698 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -