SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20823
         (455 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q3V2J5 Cluster: Adult male testis cDNA, RIKEN full-leng...    31   8.9  

>UniRef50_Q3V2J5 Cluster: Adult male testis cDNA, RIKEN full-length
           enriched library, clone:1700101G07 product:hypothetical
           Cysteine-rich region profile containing protein, full
           insert sequence; n=1; Mus musculus|Rep: Adult male
           testis cDNA, RIKEN full-length enriched library,
           clone:1700101G07 product:hypothetical Cysteine-rich
           region profile containing protein, full insert sequence
           - Mus musculus (Mouse)
          Length = 168

 Score = 31.5 bits (68), Expect = 8.9
 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 3/35 (8%)
 Frame = +2

Query: 146 CSCMIIYL*YIDIISCLVIY---LLSVRNL*LKKR 241
           C CM +Y+ YIDII  L IY   LL VR+   KK+
Sbjct: 95  CVCMYVYMRYIDIIYILYIYNVLLLPVRDHVSKKQ 129


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 364,807,065
Number of Sequences: 1657284
Number of extensions: 5703320
Number of successful extensions: 10684
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 10506
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10684
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 23931581955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -