BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20823 (455 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q3V2J5 Cluster: Adult male testis cDNA, RIKEN full-leng... 31 8.9 >UniRef50_Q3V2J5 Cluster: Adult male testis cDNA, RIKEN full-length enriched library, clone:1700101G07 product:hypothetical Cysteine-rich region profile containing protein, full insert sequence; n=1; Mus musculus|Rep: Adult male testis cDNA, RIKEN full-length enriched library, clone:1700101G07 product:hypothetical Cysteine-rich region profile containing protein, full insert sequence - Mus musculus (Mouse) Length = 168 Score = 31.5 bits (68), Expect = 8.9 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = +2 Query: 146 CSCMIIYL*YIDIISCLVIY---LLSVRNL*LKKR 241 C CM +Y+ YIDII L IY LL VR+ KK+ Sbjct: 95 CVCMYVYMRYIDIIYILYIYNVLLLPVRDHVSKKQ 129 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 364,807,065 Number of Sequences: 1657284 Number of extensions: 5703320 Number of successful extensions: 10684 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 10506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10684 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 23931581955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -