BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20819 (745 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 48 6e-06 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 48 8e-06 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 48 8e-06 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_16491| Best HMM Match : MutS_V (HMM E-Value=8.2e-11) 47 2e-05 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 46 3e-05 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 46 4e-05 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 46 4e-05 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 46 4e-05 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 45 6e-05 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 45 6e-05 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 45 6e-05 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_8214| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 45 6e-05 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) 45 6e-05 SB_20669| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 45 7e-05 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 45 7e-05 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 44 1e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 44 1e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 44 1e-04 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 44 1e-04 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 44 1e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 44 1e-04 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 44 1e-04 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 44 1e-04 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 44 1e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 44 1e-04 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 44 1e-04 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 44 1e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 44 1e-04 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 44 1e-04 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 44 1e-04 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 44 1e-04 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 44 1e-04 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 44 2e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 44 2e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 44 2e-04 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 44 2e-04 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 44 2e-04 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 44 2e-04 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 43 2e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 43 2e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 43 2e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 43 2e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 43 2e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 43 2e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 43 2e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 43 2e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 43 2e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 43 2e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 43 2e-04 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 43 2e-04 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 43 2e-04 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 43 2e-04 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 43 2e-04 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 43 2e-04 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 43 2e-04 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 43 2e-04 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 43 2e-04 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 43 2e-04 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 43 2e-04 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 43 2e-04 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 43 2e-04 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 43 2e-04 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 43 2e-04 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 43 2e-04 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 43 2e-04 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 43 2e-04 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 49.6 bits (113), Expect = 3e-06 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 ++G+ +V NSCSPGDPLVLERPPPR Sbjct: 1 MVGEGIVSNSCSPGDPLVLERPPPR 25 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 105 WHLMLLGDALVPNSCSPGDPLVLERPPPR 19 W L+++ + + NSCSPGDPLVLERPPPR Sbjct: 49 WPLLIVVPSSISNSCSPGDPLVLERPPPR 77 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 48.8 bits (111), Expect = 5e-06 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -2 Query: 108 TWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 TW L + ++ NSCSPGDPLVLERPPPR Sbjct: 7 TWALRVQRFRIISNSCSPGDPLVLERPPPR 36 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 48.8 bits (111), Expect = 5e-06 Identities = 23/40 (57%), Positives = 25/40 (62%), Gaps = 7/40 (17%) Frame = -2 Query: 117 GPHTW-------HLMLLGDALVPNSCSPGDPLVLERPPPR 19 G HTW H+ G + NSCSPGDPLVLERPPPR Sbjct: 9 GAHTWTSRAVTSHIQKKGAKEISNSCSPGDPLVLERPPPR 48 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 48.4 bits (110), Expect = 6e-06 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -2 Query: 108 TWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 +W ++L V NSCSPGDPLVLERPPPR Sbjct: 23 SWQILLQVGFKVSNSCSPGDPLVLERPPPR 52 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 48.4 bits (110), Expect = 6e-06 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 90 LGDALVPNSCSPGDPLVLERPPPR 19 LG ++ NSCSPGDPLVLERPPPR Sbjct: 22 LGSLIISNSCSPGDPLVLERPPPR 45 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 48.4 bits (110), Expect = 6e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -2 Query: 126 ASSGPHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 AS GP + + AL NSCSPGDPLVLERPPPR Sbjct: 80 ASIGPSIYGHEDIKRALASNSCSPGDPLVLERPPPR 115 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 48.0 bits (109), Expect = 8e-06 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = -2 Query: 150 IKPVGMLHASSGPHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 + PV H + P H ++V NSCSPGDPLVLERPPPR Sbjct: 329 VPPVPAFHCTQYPQYLH------SIVSNSCSPGDPLVLERPPPR 366 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 48.0 bits (109), Expect = 8e-06 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 1/25 (4%) Frame = -2 Query: 90 LGDALVP-NSCSPGDPLVLERPPPR 19 LGDA P NSCSPGDPLVLERPPPR Sbjct: 91 LGDAQPPSNSCSPGDPLVLERPPPR 115 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 47.6 bits (108), Expect = 1e-05 Identities = 25/51 (49%), Positives = 30/51 (58%) Frame = -2 Query: 171 VAANPGIIKPVGMLHASSGPHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 VA G + + + +SG H W L + NSCSPGDPLVLERPPPR Sbjct: 18 VAVTSGCHQWLSPVVVTSGCHEW---LSRVVVTSNSCSPGDPLVLERPPPR 65 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 DAL NSCSPGDPLVLERPPPR Sbjct: 21 DALSSNSCSPGDPLVLERPPPR 42 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -2 Query: 87 GDALVPNSCSPGDPLVLERPPPR 19 G LV NSCSPGDPLVLERPPPR Sbjct: 14 GRLLVSNSCSPGDPLVLERPPPR 36 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -2 Query: 99 LMLLGDALVPNSCSPGDPLVLERPPPR 19 L + G+ + NSCSPGDPLVLERPPPR Sbjct: 12 LFVQGNCMKSNSCSPGDPLVLERPPPR 38 >SB_16491| Best HMM Match : MutS_V (HMM E-Value=8.2e-11) Length = 877 Score = 46.8 bits (106), Expect = 2e-05 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 1/91 (1%) Frame = -2 Query: 492 SLLDLLLTTHPAGYSVVVDAP-LGSSDHCLIRAAIPLSRPSRRTTTGFRRVWRYRSADWD 316 ++LDL+LT+ P+ + + + S+DH LI + L+ S++T T R V+ Y+ ADW Sbjct: 720 NILDLILTSIPSKFHHIHGFDDIISTDHKLISFELDLNI-SKKTKTK-RVVYNYKRADWT 777 Query: 315 GMREFYASHPWGRLCLSSDDLTSVRTDLKTW 223 G+ E + PW LC S D ++ + L W Sbjct: 778 GLNESLKNIPWD-LCFSQSD--NIGSSLANW 805 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -2 Query: 90 LGDALVPNSCSPGDPLVLERPPPR 19 L AL NSCSPGDPLVLERPPPR Sbjct: 11 LPTALTSNSCSPGDPLVLERPPPR 34 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 L G ++ NSCSPGDPLVLERPPPR Sbjct: 28 LFGIGVLSNSCSPGDPLVLERPPPR 52 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 111 HTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 H ++ + ++ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIIISNSCSPGDPLVLERPPPR 33 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 ++ A V NSCSPGDPLVLERPPPR Sbjct: 13 IISIAFVSNSCSPGDPLVLERPPPR 37 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = -2 Query: 114 PHTWHLMLLGDALVP-NSCSPGDPLVLERPPPR 19 P LM++ + ++ NSCSPGDPLVLERPPPR Sbjct: 12 PRNAELMVVTEVIITSNSCSPGDPLVLERPPPR 44 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 90 LGDALVPNSCSPGDPLVLERPPPR 19 + +A V NSCSPGDPLVLERPPPR Sbjct: 13 IANAKVSNSCSPGDPLVLERPPPR 36 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 LV NSCSPGDPLVLERPPPR Sbjct: 24 LVSNSCSPGDPLVLERPPPR 43 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 LV NSCSPGDPLVLERPPPR Sbjct: 3 LVSNSCSPGDPLVLERPPPR 22 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 111 HTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 H ++ + ++ NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIVISNSCSPGDPLVLERPPPR 33 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 LV NSCSPGDPLVLERPPPR Sbjct: 9 LVSNSCSPGDPLVLERPPPR 28 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 +L + L NSCSPGDPLVLERPPPR Sbjct: 1 MLYNTLASNSCSPGDPLVLERPPPR 25 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 LV NSCSPGDPLVLERPPPR Sbjct: 5 LVSNSCSPGDPLVLERPPPR 24 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 LV NSCSPGDPLVLERPPPR Sbjct: 2 LVSNSCSPGDPLVLERPPPR 21 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 LV NSCSPGDPLVLERPPPR Sbjct: 26 LVSNSCSPGDPLVLERPPPR 45 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -2 Query: 96 MLLGDALVPNSCSPGDPLVLERPPPR 19 + L +V NSCSPGDPLVLERPPPR Sbjct: 79 LTLTQRIVSNSCSPGDPLVLERPPPR 104 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L+ NSCSPGDPLVLERPPPR Sbjct: 33 SLISNSCSPGDPLVLERPPPR 53 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 L+ +V NSCSPGDPLVLERPPPR Sbjct: 8 LISANIVSNSCSPGDPLVLERPPPR 32 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 LV NSCSPGDPLVLERPPPR Sbjct: 26 LVSNSCSPGDPLVLERPPPR 45 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/46 (50%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -2 Query: 153 IIKPVGMLHASSGPHTWHLML-LGDALVPNSCSPGDPLVLERPPPR 19 +I P L + G +W+ G NSCSPGDPLVLERPPPR Sbjct: 1 MITPSSKLTLTKGNKSWYRAPPRGRRAKSNSCSPGDPLVLERPPPR 46 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 102 HLMLLGDALVPNSCSPGDPLVLERPPPR 19 HL ++ + NSCSPGDPLVLERPPPR Sbjct: 62 HLRMIENRRGSNSCSPGDPLVLERPPPR 89 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L+ NSCSPGDPLVLERPPPR Sbjct: 30 SLISNSCSPGDPLVLERPPPR 50 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 17 LISNSCSPGDPLVLERPPPR 36 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -2 Query: 114 PHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 P W L ++ NSCSPGDPLVLERPPPR Sbjct: 3 PRRWWSYGLIRPVLSNSCSPGDPLVLERPPPR 34 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 37 LISNSCSPGDPLVLERPPPR 56 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -2 Query: 114 PHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 P+ W L L + NSCSPGDPLVLERPPPR Sbjct: 78 PNIWDL-LRPCIVTSNSCSPGDPLVLERPPPR 108 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 + +V NSCSPGDPLVLERPPPR Sbjct: 75 NTIVSNSCSPGDPLVLERPPPR 96 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 8 LISNSCSPGDPLVLERPPPR 27 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 L+ ++ NSCSPGDPLVLERPPPR Sbjct: 8 LISANIISNSCSPGDPLVLERPPPR 32 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 24 LISNSCSPGDPLVLERPPPR 43 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/39 (51%), Positives = 26/39 (66%) Frame = -2 Query: 135 MLHASSGPHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 ++++S GP + + NSCSPGDPLVLERPPPR Sbjct: 12 VVNSSPGPASPGFSTESPRSISNSCSPGDPLVLERPPPR 50 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 40 LISNSCSPGDPLVLERPPPR 59 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = -2 Query: 114 PHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 P +++ L + NSCSPGDPLVLERPPPR Sbjct: 2 PRQFYIFLFCCGELSNSCSPGDPLVLERPPPR 33 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 70 LISNSCSPGDPLVLERPPPR 89 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -2 Query: 87 GDALVPNSCSPGDPLVLERPPPR 19 G V NSCSPGDPLVLERPPPR Sbjct: 28 GKIAVSNSCSPGDPLVLERPPPR 50 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -2 Query: 96 MLLGDALVPNSCSPGDPLVLERPPPR 19 +L G+ NSCSPGDPLVLERPPPR Sbjct: 42 ILPGEKKTSNSCSPGDPLVLERPPPR 67 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 A + NSCSPGDPLVLERPPPR Sbjct: 50 AFISNSCSPGDPLVLERPPPR 70 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 L+ D + NSCSPGDPLVLERPPPR Sbjct: 8 LVTDEIRSNSCSPGDPLVLERPPPR 32 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 21 LISNSCSPGDPLVLERPPPR 40 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 90 LGDALVPNSCSPGDPLVLERPPPR 19 L L+ NSCSPGDPLVLERPPPR Sbjct: 3 LSSFLLSNSCSPGDPLVLERPPPR 26 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 16 LISNSCSPGDPLVLERPPPR 35 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 L+ ++ NSCSPGDPLVLERPPPR Sbjct: 8 LISANIISNSCSPGDPLVLERPPPR 32 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 99 LMLLGDALVPNSCSPGDPLVLERPPPR 19 LM L NSCSPGDPLVLERPPPR Sbjct: 4 LMAHESGLTSNSCSPGDPLVLERPPPR 30 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -2 Query: 123 SSGPHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 SS P L+L G + NSCSPGDPLVLERPPPR Sbjct: 16 SSSPVLLKLVLQG---LSNSCSPGDPLVLERPPPR 47 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/26 (80%), Positives = 22/26 (84%), Gaps = 3/26 (11%) Frame = -2 Query: 87 GDALVP---NSCSPGDPLVLERPPPR 19 G +LVP NSCSPGDPLVLERPPPR Sbjct: 19 GASLVPRPSNSCSPGDPLVLERPPPR 44 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 +A + NSCSPGDPLVLERPPPR Sbjct: 2 NAQISNSCSPGDPLVLERPPPR 23 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 45.2 bits (102), Expect = 6e-05 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = -2 Query: 126 ASSGPHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 A++GP H L + NSCSPGDPLVLERPPPR Sbjct: 878 AATGPSLSHPFPL---VTSNSCSPGDPLVLERPPPR 910 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 45.2 bits (102), Expect = 6e-05 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 5/38 (13%) Frame = -2 Query: 117 GPHTWHLMLLG----DALVP-NSCSPGDPLVLERPPPR 19 GPH +LG A VP NSCSPGDPLVLERPPPR Sbjct: 23 GPHQDCNKMLGLCLKQANVPSNSCSPGDPLVLERPPPR 60 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 D + NSCSPGDPLVLERPPPR Sbjct: 35 DNIASNSCSPGDPLVLERPPPR 56 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -2 Query: 99 LMLLGDALVPNSCSPGDPLVLERPPPR 19 ++L+ D NSCSPGDPLVLERPPPR Sbjct: 21 ILLVHDHNQSNSCSPGDPLVLERPPPR 47 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -2 Query: 87 GDALVPNSCSPGDPLVLERPPPR 19 G L NSCSPGDPLVLERPPPR Sbjct: 75 GILLTSNSCSPGDPLVLERPPPR 97 >SB_8214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 45.2 bits (102), Expect = 6e-05 Identities = 30/91 (32%), Positives = 51/91 (56%), Gaps = 1/91 (1%) Frame = -2 Query: 492 SLLDLLLTTHPAGYSVVVDAP-LGSSDHCLIRAAIPLSRPSRRTTTGFRRVWRYRSADWD 316 ++LDL+LT+ P+ + + + S+DH LI + L+ S++T T R V+ ++ ADW Sbjct: 34 NILDLILTSIPSKFHHIHGFDDIISTDHKLISFELDLNI-SKKTKTK-RVVYNFKRADWT 91 Query: 315 GMREFYASHPWGRLCLSSDDLTSVRTDLKTW 223 G+ E + PW LC S D ++ + L W Sbjct: 92 GLNESLKNIPWD-LCFSQSD--NIDSSLANW 119 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 45.2 bits (102), Expect = 6e-05 Identities = 22/38 (57%), Positives = 26/38 (68%), Gaps = 6/38 (15%) Frame = -2 Query: 114 PHTWHLMLLGDAL------VPNSCSPGDPLVLERPPPR 19 P+ + + +G AL V NSCSPGDPLVLERPPPR Sbjct: 3456 PYNYPVSAIGKALIYVARVVSNSCSPGDPLVLERPPPR 3493 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/34 (61%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = -2 Query: 114 PHTWHLMLLGDAL--VPNSCSPGDPLVLERPPPR 19 P TW L + NSCSPGDPLVLERPPPR Sbjct: 137 PSTWFPYSRNSRLEKISNSCSPGDPLVLERPPPR 170 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 90 LGDALVPNSCSPGDPLVLERPPPR 19 + D + NSCSPGDPLVLERPPPR Sbjct: 2 IADDEISNSCSPGDPLVLERPPPR 25 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 +V NSCSPGDPLVLERPPPR Sbjct: 11 MVSNSCSPGDPLVLERPPPR 30 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 + L NSCSPGDPLVLERPPPR Sbjct: 15 EVLASNSCSPGDPLVLERPPPR 36 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 A+ NSCSPGDPLVLERPPPR Sbjct: 2420 AIASNSCSPGDPLVLERPPPR 2440 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -2 Query: 102 HLMLLGDALVPNSCSPGDPLVLERPPPR 19 +L+ L ++ NSCSPGDPLVLERPPPR Sbjct: 57 NLLALTVFMLSNSCSPGDPLVLERPPPR 84 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 +V NSCSPGDPLVLERPPPR Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/38 (55%), Positives = 23/38 (60%) Frame = -2 Query: 132 LHASSGPHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 LH S H + + NSCSPGDPLVLERPPPR Sbjct: 16 LHTSQALHHPFIQAKPYNIPSNSCSPGDPLVLERPPPR 53 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -2 Query: 87 GDALVPNSCSPGDPLVLERPPPR 19 G+ V NSCSPGDPLVLERPPPR Sbjct: 27 GNKDVSNSCSPGDPLVLERPPPR 49 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -2 Query: 102 HLMLLGDALVPNSCSPGDPLVLERPPPR 19 H + D + NSCSPGDPLVLERPPPR Sbjct: 2 HRSHMEDEIRSNSCSPGDPLVLERPPPR 29 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 +A + NSCSPGDPLVLERPPPR Sbjct: 43 EAALSNSCSPGDPLVLERPPPR 64 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 90 LGDALVPNSCSPGDPLVLERPPPR 19 + A V NSCSPGDPLVLERPPPR Sbjct: 1 MNKAEVSNSCSPGDPLVLERPPPR 24 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -2 Query: 111 HTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 H ++ + V NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANISVSNSCSPGDPLVLERPPPR 33 >SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) Length = 715 Score = 45.2 bits (102), Expect = 6e-05 Identities = 30/91 (32%), Positives = 51/91 (56%), Gaps = 1/91 (1%) Frame = -2 Query: 492 SLLDLLLTTHPAGYSVVVDAP-LGSSDHCLIRAAIPLSRPSRRTTTGFRRVWRYRSADWD 316 ++LDL+LT+ P+ + + + S+DH LI + L+ S++T T R V+ ++ ADW Sbjct: 179 NILDLILTSIPSKFHHIHGFDDIISTDHKLISFELDLNI-SKKTKTK-RVVYNFKRADWT 236 Query: 315 GMREFYASHPWGRLCLSSDDLTSVRTDLKTW 223 G+ E + PW LC S D ++ + L W Sbjct: 237 GLNESLKNIPWD-LCFSQSD--NIDSSLANW 264 >SB_20669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 96 MLLGDALVPNSCSPGDPLVLERPPPR 19 ML GD NSCSPGDPLVLERPPPR Sbjct: 1 MLKGDG--SNSCSPGDPLVLERPPPR 24 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -2 Query: 102 HLMLLGDALVPNSCSPGDPLVLERPPPR 19 ++ L G NSCSPGDPLVLERPPPR Sbjct: 12 NIRLRGICAASNSCSPGDPLVLERPPPR 39 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 +V NSCSPGDPLVLERPPPR Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 D + NSCSPGDPLVLERPPPR Sbjct: 10 DIVASNSCSPGDPLVLERPPPR 31 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 62 LLSNSCSPGDPLVLERPPPR 81 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 L+ ++ NSCSPGDPLVLERPPPR Sbjct: 8 LISANILSNSCSPGDPLVLERPPPR 32 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -2 Query: 102 HLMLLGDALVPNSCSPGDPLVLERPPPR 19 H+ ++G L NSCSPGDPLVLERPPPR Sbjct: 1014 HVFVVG--LGSNSCSPGDPLVLERPPPR 1039 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 44.8 bits (101), Expect = 7e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 ++ NSCSPGDPLVLERPPPR Sbjct: 119 IISNSCSPGDPLVLERPPPR 138 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -2 Query: 111 HTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 H ++ + + NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIFLSNSCSPGDPLVLERPPPR 33 >SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -2 Query: 87 GDALVPNSCSPGDPLVLERPPPR 19 GD NSCSPGDPLVLERPPPR Sbjct: 29 GDGDGSNSCSPGDPLVLERPPPR 51 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -2 Query: 87 GDALVPNSCSPGDPLVLERPPPR 19 G L NSCSPGDPLVLERPPPR Sbjct: 24 GKHLPSNSCSPGDPLVLERPPPR 46 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -2 Query: 102 HLMLLGDALVPNSCSPGDPLVLERPPPR 19 H ++ + NSCSPGDPLVLERPPPR Sbjct: 43 HKIVKSSSRASNSCSPGDPLVLERPPPR 70 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 +V NSCSPGDPLVLERPPPR Sbjct: 7 VVSNSCSPGDPLVLERPPPR 26 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 54 LLSNSCSPGDPLVLERPPPR 73 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 2 LLSNSCSPGDPLVLERPPPR 21 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 A V NSCSPGDPLVLERPPPR Sbjct: 23 AHVSNSCSPGDPLVLERPPPR 43 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 A + NSCSPGDPLVLERPPPR Sbjct: 16 ASISNSCSPGDPLVLERPPPR 36 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 6 LLSNSCSPGDPLVLERPPPR 25 >SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 90 LGDALVPNSCSPGDPLVLERPPPR 19 +G NSCSPGDPLVLERPPPR Sbjct: 1 MGTVQASNSCSPGDPLVLERPPPR 24 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 +V NSCSPGDPLVLERPPPR Sbjct: 19 VVSNSCSPGDPLVLERPPPR 38 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 7e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 ++ NSCSPGDPLVLERPPPR Sbjct: 5 IISNSCSPGDPLVLERPPPR 24 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 + V NSCSPGDPLVLERPPPR Sbjct: 12 SFVSNSCSPGDPLVLERPPPR 32 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 L G NSCSPGDPLVLERPPPR Sbjct: 10 LAGSPFRSNSCSPGDPLVLERPPPR 34 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -2 Query: 96 MLLGDALVPNSCSPGDPLVLERPPPR 19 +L L NSCSPGDPLVLERPPPR Sbjct: 5 ILCTQELTSNSCSPGDPLVLERPPPR 30 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.8 bits (101), Expect = 7e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 ++ NSCSPGDPLVLERPPPR Sbjct: 1 MISNSCSPGDPLVLERPPPR 20 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L+ NSCSPGDPLVLERPPPR Sbjct: 1 LLSNSCSPGDPLVLERPPPR 20 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 87 GDALVPNSCSPGDPLVLERPPPR 19 G + NSCSPGDPLVLERPPPR Sbjct: 59 GSNFLSNSCSPGDPLVLERPPPR 81 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.8 bits (101), Expect = 7e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 ++ NSCSPGDPLVLERPPPR Sbjct: 4 IISNSCSPGDPLVLERPPPR 23 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 1/21 (4%) Frame = -2 Query: 78 LVP-NSCSPGDPLVLERPPPR 19 LVP NSCSPGDPLVLERPPPR Sbjct: 27 LVPSNSCSPGDPLVLERPPPR 47 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L NSCSPGDPLVLERPPPR Sbjct: 14 SLTSNSCSPGDPLVLERPPPR 34 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 +V NSCSPGDPLVLERPPPR Sbjct: 27 VVSNSCSPGDPLVLERPPPR 46 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 + L NSCSPGDPLVLERPPPR Sbjct: 5 EPLASNSCSPGDPLVLERPPPR 26 >SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -2 Query: 111 HTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 HT +L + NSCSPGDPLVLERPPPR Sbjct: 38 HTHYLGEMEVTHTSNSCSPGDPLVLERPPPR 68 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/28 (67%), Positives = 22/28 (78%), Gaps = 2/28 (7%) Frame = -2 Query: 96 MLLGDALVP--NSCSPGDPLVLERPPPR 19 ++ G +P NSCSPGDPLVLERPPPR Sbjct: 174 VIAGTTTIPPSNSCSPGDPLVLERPPPR 201 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 L+ + NSCSPGDPLVLERPPPR Sbjct: 8 LISANIASNSCSPGDPLVLERPPPR 32 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -2 Query: 87 GDALVPNSCSPGDPLVLERPPPR 19 G NSCSPGDPLVLERPPPR Sbjct: 16 GSQTASNSCSPGDPLVLERPPPR 38 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 2 VSNSCSPGDPLVLERPPPR 20 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 40 VSNSCSPGDPLVLERPPPR 58 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 117 VSNSCSPGDPLVLERPPPR 135 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 184 VSNSCSPGDPLVLERPPPR 202 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 + ++ NSCSPGDPLVLERPPPR Sbjct: 53 EPILSNSCSPGDPLVLERPPPR 74 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 1066 VSNSCSPGDPLVLERPPPR 1084 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 A + NSCSPGDPLVLERPPPR Sbjct: 2 ANISNSCSPGDPLVLERPPPR 22 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 90 LGDALVPNSCSPGDPLVLERPPPR 19 +G NSCSPGDPLVLERPPPR Sbjct: 1 MGHPFSSNSCSPGDPLVLERPPPR 24 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 214 VSNSCSPGDPLVLERPPPR 232 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L NSCSPGDPLVLERPPPR Sbjct: 5 LASNSCSPGDPLVLERPPPR 24 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 5 VSNSCSPGDPLVLERPPPR 23 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 64 VSNSCSPGDPLVLERPPPR 82 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 A+ NSCSPGDPLVLERPPPR Sbjct: 797 AISSNSCSPGDPLVLERPPPR 817 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 L+ + NSCSPGDPLVLERPPPR Sbjct: 8 LISANITSNSCSPGDPLVLERPPPR 32 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 11 VSNSCSPGDPLVLERPPPR 29 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 59 VSNSCSPGDPLVLERPPPR 77 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 41 VSNSCSPGDPLVLERPPPR 59 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 ++ NSCSPGDPLVLERPPPR Sbjct: 5 VISNSCSPGDPLVLERPPPR 24 >SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) Length = 481 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 +A NSCSPGDPLVLERPPPR Sbjct: 354 EASASNSCSPGDPLVLERPPPR 375 >SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -2 Query: 111 HTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 H ++ + + NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIISSNSCSPGDPLVLERPPPR 33 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L NSCSPGDPLVLERPPPR Sbjct: 37 LTSNSCSPGDPLVLERPPPR 56 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L NSCSPGDPLVLERPPPR Sbjct: 20 LASNSCSPGDPLVLERPPPR 39 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 17 VSNSCSPGDPLVLERPPPR 35 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/54 (46%), Positives = 29/54 (53%) Frame = -2 Query: 180 PLGVAANPGIIKPVGMLHASSGPHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 PL V +P G + T+ +LL NSCSPGDPLVLERPPPR Sbjct: 10 PLCVGTHPLHPPEYGPVALYGLDRTYLFVLLVANKPSNSCSPGDPLVLERPPPR 63 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 14 VSNSCSPGDPLVLERPPPR 32 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L NSCSPGDPLVLERPPPR Sbjct: 88 LTSNSCSPGDPLVLERPPPR 107 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L NSCSPGDPLVLERPPPR Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 ++ NSCSPGDPLVLERPPPR Sbjct: 17 VISNSCSPGDPLVLERPPPR 36 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 8 VSNSCSPGDPLVLERPPPR 26 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 23 VSNSCSPGDPLVLERPPPR 41 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L NSCSPGDPLVLERPPPR Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L NSCSPGDPLVLERPPPR Sbjct: 3 LASNSCSPGDPLVLERPPPR 22 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -2 Query: 87 GDALVPNSCSPGDPLVLERPPPR 19 G L NSCSPGDPLVLERPPPR Sbjct: 210 GKHLRSNSCSPGDPLVLERPPPR 232 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L NSCSPGDPLVLERPPPR Sbjct: 661 LASNSCSPGDPLVLERPPPR 680 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 27 VSNSCSPGDPLVLERPPPR 45 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 193 VSNSCSPGDPLVLERPPPR 211 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 9 VSNSCSPGDPLVLERPPPR 27 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 17 VSNSCSPGDPLVLERPPPR 35 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 ++ NSCSPGDPLVLERPPPR Sbjct: 25 VISNSCSPGDPLVLERPPPR 44 >SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 99 LMLLGDALVPNSCSPGDPLVLERPPPR 19 L L+ + NSCSPGDPLVLERPPPR Sbjct: 4 LYLITRGVSSNSCSPGDPLVLERPPPR 30 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 L NSCSPGDPLVLERPPPR Sbjct: 4 LASNSCSPGDPLVLERPPPR 23 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 101 ISNSCSPGDPLVLERPPPR 119 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 87 GDALVPNSCSPGDPLVLERPPPR 19 G + NSCSPGDPLVLERPPPR Sbjct: 49 GFRVASNSCSPGDPLVLERPPPR 71 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 261 ISNSCSPGDPLVLERPPPR 279 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 +A+ NSCSPGDPLVLERPPPR Sbjct: 10 NAVRSNSCSPGDPLVLERPPPR 31 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/37 (54%), Positives = 25/37 (67%) Frame = -2 Query: 129 HASSGPHTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 H+ S P ++++ NSCSPGDPLVLERPPPR Sbjct: 62 HSRSKPRIIIIIIIIIWAGSNSCSPGDPLVLERPPPR 98 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 A + NSCSPGDPLVLERPPPR Sbjct: 33 ASLSNSCSPGDPLVLERPPPR 53 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 9 ISNSCSPGDPLVLERPPPR 27 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 10 ISNSCSPGDPLVLERPPPR 28 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 3 ISNSCSPGDPLVLERPPPR 21 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 D + NSCSPGDPLVLERPPPR Sbjct: 14 DIPLSNSCSPGDPLVLERPPPR 35 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 13 ISNSCSPGDPLVLERPPPR 31 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 52 ISNSCSPGDPLVLERPPPR 70 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 51 ISNSCSPGDPLVLERPPPR 69 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L NSCSPGDPLVLERPPPR Sbjct: 3 SLSSNSCSPGDPLVLERPPPR 23 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -2 Query: 102 HLMLLGDALVPNSCSPGDPLVLERPPPR 19 H +L D NSCSPGDPLVLERPPPR Sbjct: 551 HSKILSDR--SNSCSPGDPLVLERPPPR 576 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -2 Query: 102 HLMLLGDALVPNSCSPGDPLVLERPPPR 19 H++ + NSCSPGDPLVLERPPPR Sbjct: 15 HVVYINIIRQSNSCSPGDPLVLERPPPR 42 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 93 LLGDALVPNSCSPGDPLVLERPPPR 19 ++ L NSCSPGDPLVLERPPPR Sbjct: 1 MIQTGLPSNSCSPGDPLVLERPPPR 25 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 47 ISNSCSPGDPLVLERPPPR 65 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 A NSCSPGDPLVLERPPPR Sbjct: 2 AATSNSCSPGDPLVLERPPPR 22 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 D + NSCSPGDPLVLERPPPR Sbjct: 20 DRHLSNSCSPGDPLVLERPPPR 41 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -2 Query: 111 HTWHLMLLGDALVPNSCSPGDPLVLERPPPR 19 H ++ + + NSCSPGDPLVLERPPPR Sbjct: 3 HFTDTLISANIVESNSCSPGDPLVLERPPPR 33 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 974 ISNSCSPGDPLVLERPPPR 992 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 6 ISNSCSPGDPLVLERPPPR 24 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 1/25 (4%) Frame = -2 Query: 90 LGDALVP-NSCSPGDPLVLERPPPR 19 LG+ L NSCSPGDPLVLERPPPR Sbjct: 13 LGEYLTASNSCSPGDPLVLERPPPR 37 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 84 DALVPNSCSPGDPLVLERPPPR 19 + L NSCSPGDPLVLERPPPR Sbjct: 83 EPLSSNSCSPGDPLVLERPPPR 104 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -2 Query: 105 WHLMLLGDALVPNSCSPGDPLVLERPPPR 19 W L ++ NSCSPGDPLVLERPPPR Sbjct: 4 WPSELEKRQVLSNSCSPGDPLVLERPPPR 32 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 1 ISNSCSPGDPLVLERPPPR 19 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 90 LGDALVPNSCSPGDPLVLERPPPR 19 L + + NSCSPGDPLVLERPPPR Sbjct: 80 LNEHSLSNSCSPGDPLVLERPPPR 103 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 116 ISNSCSPGDPLVLERPPPR 134 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 +L NSCSPGDPLVLERPPPR Sbjct: 5 SLSSNSCSPGDPLVLERPPPR 25 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 14 ISNSCSPGDPLVLERPPPR 32 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 8 ISNSCSPGDPLVLERPPPR 26 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -2 Query: 99 LMLLGDALVPNSCSPGDPLVLERPPPR 19 L + + + NSCSPGDPLVLERPPPR Sbjct: 163 LFMQYELFLSNSCSPGDPLVLERPPPR 189 >SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 822 Score = 44.0 bits (99), Expect = 1e-04 Identities = 29/91 (31%), Positives = 50/91 (54%), Gaps = 1/91 (1%) Frame = -2 Query: 492 SLLDLLLTTHPAGYSVVVDAP-LGSSDHCLIRAAIPLSRPSRRTTTGFRRVWRYRSADWD 316 ++LD +LT+ P+ + + + S+DH LI + L+ S++T T R V+ ++ ADW Sbjct: 172 NILDFILTSIPSKFQHIHGFDDIISTDHKLISFELDLNI-SKKTKTK-RVVYNFKRADWT 229 Query: 315 GMREFYASHPWGRLCLSSDDLTSVRTDLKTW 223 G+ E + PW LC S D ++ + L W Sbjct: 230 GLNESLKNIPWD-LCFSQSD--NIDSSLANW 257 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 105 WHLMLLGDALVPNSCSPGDPLVLERPPPR 19 W+ LL + NSCSPGDPLVLERPPPR Sbjct: 36 WNRQLLNAS---NSCSPGDPLVLERPPPR 61 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 102 HLMLLGDALVPNSCSPGDPLVLERPPPR 19 HL L NSCSPGDPLVLERPPPR Sbjct: 55 HLRSLYFPETSNSCSPGDPLVLERPPPR 82 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -2 Query: 99 LMLLGDALVPNSCSPGDPLVLERPPPR 19 L + + NSCSPGDPLVLERPPPR Sbjct: 30 LFIPSTQMASNSCSPGDPLVLERPPPR 56 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 90 ISNSCSPGDPLVLERPPPR 108 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 ++ NSCSPGDPLVLERPPPR Sbjct: 104 ILSNSCSPGDPLVLERPPPR 123 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 7 ISNSCSPGDPLVLERPPPR 25 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 78 LVPNSCSPGDPLVLERPPPR 19 ++ NSCSPGDPLVLERPPPR Sbjct: 12 ILSNSCSPGDPLVLERPPPR 31 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 6 ISNSCSPGDPLVLERPPPR 24 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 68 ISNSCSPGDPLVLERPPPR 86 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 46 ISNSCSPGDPLVLERPPPR 64 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 45 ISNSCSPGDPLVLERPPPR 63 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 81 ALVPNSCSPGDPLVLERPPPR 19 ++ NSCSPGDPLVLERPPPR Sbjct: 18 SITSNSCSPGDPLVLERPPPR 38 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 591 ISNSCSPGDPLVLERPPPR 609 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 102 HLMLLGDALVPNSCSPGDPLVLERPPPR 19 +L+ + + NSCSPGDPLVLERPPPR Sbjct: 137 NLLFSINLITSNSCSPGDPLVLERPPPR 164 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 12 ISNSCSPGDPLVLERPPPR 30 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 10 ISNSCSPGDPLVLERPPPR 28 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 75 VPNSCSPGDPLVLERPPPR 19 + NSCSPGDPLVLERPPPR Sbjct: 10 ISNSCSPGDPLVLERPPPR 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,403,943 Number of Sequences: 59808 Number of extensions: 718560 Number of successful extensions: 4155 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4126 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -