BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20818 (710 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A3.11c |||mitochondrial carboxylic acid transporter|Schizo... 27 3.5 SPBC1709.17 |||folylpolyglutamate synthase|Schizosaccharomyces p... 26 4.6 >SPBC29A3.11c |||mitochondrial carboxylic acid transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 297 Score = 26.6 bits (56), Expect = 3.5 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 424 YSKIQILNNSVDDTNRNFMSFSKCQSFISLTKCNFHY 534 Y +++ VD T R F+S +FISL C F Y Sbjct: 91 YDSLKLTFAHVDPTLRYFISGLGTGTFISLFACPFEY 127 >SPBC1709.17 |||folylpolyglutamate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 505 Score = 26.2 bits (55), Expect = 4.6 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 300 KKIPSYFVKFTSQFLITVCSITQVNSKKISLE 395 + IP +TS L +VC Q+N K IS E Sbjct: 110 RSIPKCIGMYTSPHLRSVCERIQLNGKPISQE 141 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,684,838 Number of Sequences: 5004 Number of extensions: 53579 Number of successful extensions: 114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -