BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20818 (710 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0505 + 6599181-6599249,6599537-6599632,6599931-6599962,660... 30 2.1 >04_01_0505 + 6599181-6599249,6599537-6599632,6599931-6599962, 6601191-6601428,6601852-6601905,6601923-6602130, 6602353-6602590,6602788-6602962,6603074-6603442 Length = 492 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +1 Query: 406 ITIIASYSKIQILNNSVDDTNRNFMSFS--KCQSFISLTKCNF 528 + +I ++SK Q +N +DT RNF S KC + SL ++ Sbjct: 45 VQLIFTHSKSQEKDNEDNDTTRNFKSIRLWKCNKYQSLASASY 87 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,762,518 Number of Sequences: 37544 Number of extensions: 253660 Number of successful extensions: 407 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 407 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -