BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20818 (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 3.8 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 6.6 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 6.6 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 288 FCRIKKIPSYFVKFTSQFLITVCSITQVNSKKISL 392 FC I K Y VK T + +I S+ + + ISL Sbjct: 140 FCAITKPLKYGVKRTPRRMIVYVSLVWLGAACISL 174 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -2 Query: 88 FNNIILQNIYIHL 50 F+NII+ N+YI + Sbjct: 130 FHNIIMPNVYIRI 142 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -2 Query: 88 FNNIILQNIYIHL 50 F+NII+ N+YI + Sbjct: 130 FHNIIMPNVYIRI 142 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,954 Number of Sequences: 438 Number of extensions: 3878 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -