BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20809 (409 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0537 + 25363026-25363217,25363672-25363828,25364660-253646... 38 0.003 01_01_0572 - 4244714-4245311,4245694-4245736,4246172-4246283,424... 36 0.012 05_02_0073 + 6336649-6336710,6336846-6336894,6338079-6338468,633... 30 0.62 09_02_0053 - 3665202-3665900,3666109-3666359,3666612-3666938,366... 30 0.81 01_06_1742 - 39585879-39585994,39586089-39586238,39586288-395863... 30 0.81 09_06_0352 + 22472369-22472731,22472829-22472941,22473420-224742... 29 1.4 04_03_0659 - 18453778-18453903,18453976-18454963,18455496-184562... 29 1.4 11_01_0288 + 2151552-2151581,2151818-2151893,2152019-2153460 28 2.5 11_01_0110 + 850780-850805,851465-851537,851558-851720,851947-85... 28 2.5 07_03_1533 + 27523811-27524710 28 2.5 06_03_0602 - 22666227-22668740 28 2.5 06_02_0008 - 10552066-10552116,10552224-10552323,10552394-105524... 28 2.5 04_04_0376 + 24809804-24809888,24810575-24810703,24810797-248110... 28 3.3 04_01_0263 - 3532481-3532656,3532710-3532719,3532754-3532785,353... 28 3.3 03_03_0158 - 14951504-14951568,14952722-14952797,14952876-149529... 28 3.3 01_03_0003 + 11509530-11512772 28 3.3 11_06_0473 - 23992243-23992542,23993737-23993796 27 4.3 09_06_0241 + 21803476-21803604,21804968-21805026,21805117-21805444 27 4.3 09_04_0500 - 18120287-18122233 27 4.3 08_02_0911 + 22530370-22530497,22531083-22531126,22531224-225312... 27 4.3 01_01_1197 - 9630506-9630681,9630774-9630805,9630894-9630988,963... 27 4.3 09_06_0199 + 21526872-21527250,21527431-21527594,21527673-215277... 27 5.7 08_01_0626 - 5445676-5446687,5447099-5447430 27 5.7 01_01_0652 + 4975091-4975585 27 5.7 >03_05_0537 + 25363026-25363217,25363672-25363828,25364660-25364694, 25364803-25364848,25365277-25365311 Length = 154 Score = 37.9 bits (84), Expect = 0.003 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = +3 Query: 255 KKHHWLKVDFNRWQDEDESGD---DLDNMNDMFSDKD 356 +KH ++KVD+N+W DEDE D D D+ D +D+D Sbjct: 97 EKHPYIKVDWNKWCDEDEESDAPVDSDDAFDEGNDRD 133 >01_01_0572 - 4244714-4245311,4245694-4245736,4246172-4246283, 4246462-4246551,4246625-4246787,4246909-4247015, 4247149-4247230,4247314-4247351,4247434-4247542, 4248031-4248095,4248358-4248468,4248610-4248747 Length = 551 Score = 35.9 bits (79), Expect = 0.012 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = +3 Query: 279 DFNRWQDEDESGDDLDNMNDMFSDKDMNIQFGGDNEKDDSSSG 407 D N QD+D +D+++++D+ SD+D + + G KDD SSG Sbjct: 400 DVNPEQDKDGGQEDVESLDDLSSDEDEDRDYNG---KDDDSSG 439 >05_02_0073 + 6336649-6336710,6336846-6336894,6338079-6338468, 6338677-6338902,6338983-6339270,6339594-6339967, 6340044-6340736 Length = 693 Score = 30.3 bits (65), Expect = 0.62 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 291 WQDEDESGDDLDNMNDMFSDKDMNIQFGGDNEKDDSSS 404 + DED+ D D +NDM + D + G D +K +S S Sbjct: 503 FDDEDDEDDKFDFLNDMSTYADTKVPQGEDFDKLESDS 540 >09_02_0053 - 3665202-3665900,3666109-3666359,3666612-3666938, 3667017-3667242,3667328-3667846,3668789-3668863, 3668963-3669052,3669142-3669222,3672176-3672222, 3672620-3672685,3673834-3673930,3673983-3674046, 3674160-3674278,3674448-3674563,3676675-3676708 Length = 936 Score = 29.9 bits (64), Expect = 0.81 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 297 DEDESGDDLDNMNDMFSDKDMNIQFGGDNEKDDSSS 404 D D+ D+LDN NDM + + G D++K ++ S Sbjct: 743 DFDDEADELDNFNDMSTYAETKYPQGEDSDKLEADS 778 >01_06_1742 - 39585879-39585994,39586089-39586238,39586288-39586375, 39586479-39586640,39586753-39586877,39586992-39587030, 39587290-39587476,39587643-39587713,39589371-39589564, 39589656-39589767,39589899-39590082,39590177-39590503, 39590780-39591061,39591148-39591621,39591730-39591813, 39591850-39591939,39592024-39592247,39592503-39592600, 39592679-39593169,39593249-39593520,39594266-39594522, 39594672-39594890,39595007-39595167,39595249-39595441, 39595528-39595633,39595947-39596121,39596404-39596556, 39596663-39596794,39597120-39597184,39597754-39597819, 39598433-39598511,39598587-39598767,39598864-39598976 Length = 1889 Score = 29.9 bits (64), Expect = 0.81 Identities = 12/36 (33%), Positives = 25/36 (69%) Frame = +3 Query: 297 DEDESGDDLDNMNDMFSDKDMNIQFGGDNEKDDSSS 404 D+DESGD+ D +++ ++ + + + G + +D+SSS Sbjct: 1717 DDDESGDEDDGSDELPAEMESSEEEDGSDGQDESSS 1752 >09_06_0352 + 22472369-22472731,22472829-22472941,22473420-22474226, 22474314-22474620,22474862-22475027,22475491-22475534, 22476019-22476161,22477900-22477937,22478032-22478129, 22478130-22478220,22478514-22478693,22479311-22479495, 22479583-22479678,22480151-22480297,22480763-22480864, 22480932-22481564 Length = 1170 Score = 29.1 bits (62), Expect = 1.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 291 WQDEDESGDDLDNMNDMFSDKDMN 362 W D+DES D DN +D SD+ ++ Sbjct: 374 WHDDDESNDTADNWHDDNSDQPID 397 >04_03_0659 - 18453778-18453903,18453976-18454963,18455496-18456229, 18456292-18456360,18456528-18456605,18456703-18456789, 18456881-18456931,18457021-18457092,18457177-18457304, 18458194-18458275,18458705-18458754,18459043-18459096, 18459586-18459675,18459903-18459983,18460443-18460538, 18460960-18461022,18461313-18461402,18461630-18461698, 18462051-18462291 Length = 1082 Score = 29.1 bits (62), Expect = 1.4 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +3 Query: 279 DFNRWQDEDESGDDLDNMN-DMFS-DKDMNIQFGGDNEKD 392 D N+ +DED ++L+N N DMF+ N+Q DN + Sbjct: 415 DTNQVEDEDLEDNELENWNLDMFNLSNGQNVQNSADNSTE 454 >11_01_0288 + 2151552-2151581,2151818-2151893,2152019-2153460 Length = 515 Score = 28.3 bits (60), Expect = 2.5 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +3 Query: 276 VDFNRWQDEDESGDDLDNMNDMFSDKDMNIQFGGDNEKDD 395 V FN ED+ GDD +D F + D F D DD Sbjct: 191 VKFNLPPPEDDFGDDGSEFDDEFDEFDDEDDFDDDGLDDD 230 >11_01_0110 + 850780-850805,851465-851537,851558-851720,851947-852260, 852330-852409,852506-852848,853068-853166,853240-853360, 853567-853723,853976-854099,855275-855368,855866-857259, 857882-857924,858240-858458,859379-859605,859701-859948, 860246-860552,860725-861153 Length = 1486 Score = 28.3 bits (60), Expect = 2.5 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 288 RWQDEDESGDDLDNMNDMFSDKDMNIQFGGDNEKDDSS 401 RW D+ D L+ ++ +F + + I FG D+S Sbjct: 670 RWHASDDESDGLNYVDSVFGEIESTISFGDYGADSDTS 707 >07_03_1533 + 27523811-27524710 Length = 299 Score = 28.3 bits (60), Expect = 2.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 297 DEDESGDDLDNMNDMFSDKDMNIQFGGDNEKDDSSSG 407 D+D+ DD D+ +D D D + Q GGD++ G Sbjct: 61 DDDDDDDDDDDDDDDDDDDDEDDQGGGDDDGGGGGGG 97 Score = 27.5 bits (58), Expect = 4.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 297 DEDESGDDLDNMNDMFSDKDMNIQFGGDNEKDD 395 DED GDD D+ +D D D + D++ DD Sbjct: 204 DEDHGGDDDDDHDDDDDDDDDDDDDDDDDDDDD 236 Score = 26.6 bits (56), Expect = 7.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 294 QDEDESGDDLDNMNDMFSDKDMNIQFGGDNEKDD 395 +D+D GDD D+ D D D + D++ DD Sbjct: 196 EDDDSGGDDEDHGGDDDDDHDDDDDDDDDDDDDD 229 >06_03_0602 - 22666227-22668740 Length = 837 Score = 28.3 bits (60), Expect = 2.5 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 6/75 (8%) Frame = -3 Query: 263 VFLLSLVNEGQYGSSTFSFANSTSINLPLLTHMLFLGSTSA*SGIKTSCIFFSGSH---- 96 + LL L N G F+ NS+S+NL L F+GS S I + + S S Sbjct: 256 LILLDLTNNRLGGEIPFALFNSSSLNLISLAVNNFVGSIPPISNISSPLWYLSLSQNNLS 315 Query: 95 --IPLNVIDLGSMFI 57 IP ++ +L S+ I Sbjct: 316 GSIPSSIENLSSLEI 330 >06_02_0008 - 10552066-10552116,10552224-10552323,10552394-10552449, 10553950-10557180 Length = 1145 Score = 28.3 bits (60), Expect = 2.5 Identities = 16/55 (29%), Positives = 31/55 (56%) Frame = -3 Query: 275 FKPMVFLLSLVNEGQYGSSTFSFANSTSINLPLLTHMLFLGSTSA*SGIKTSCIF 111 ++P F+L N ++ + F+ +N+TS L+T +L L + + GI+T +F Sbjct: 315 YRPATFVLRRHNLRRF--NIFTCSNATSFVASLVTIILLLSTELSRHGIRTQALF 367 >04_04_0376 + 24809804-24809888,24810575-24810703,24810797-24811020, 24811398-24811607,24811697-24811789,24811899-24811937, 24812041-24812130,24812214-24812316,24812388-24812468, 24812929-24813005,24813156-24813236,24814165-24814256, 24814536-24814662 Length = 476 Score = 27.9 bits (59), Expect = 3.3 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 228 ILAFINK**KKHHWLKVDFNRWQDED-ESGDDLDNMNDMFSDKDMNIQFGGDNEKD 392 +LA + K + ++ DF+++Q E E+ +++ D +D D+N + G D+ D Sbjct: 59 LLAVVTKKDQPDEGIEDDFDKFQKEVIEAEAEVEASTDKAADNDINQEHGADDPDD 114 >04_01_0263 - 3532481-3532656,3532710-3532719,3532754-3532785, 3533237-3533348,3533586-3533649,3533778-3533843, 3533946-3534073,3534205-3534342,3534427-3534539, 3534611-3534776,3535045-3535107,3535197-3535304, 3535408-3535524,3535620-3535785,3535942-3536039, 3536136-3536233,3536378-3536514,3536654-3536878, 3536971-3537176,3537286-3537525 Length = 820 Score = 27.9 bits (59), Expect = 3.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 136 LYAEVDPKKSMWVNKGRLIEVLLAKEKVDEP 228 L +D +M V G +I+ LLA +KVD P Sbjct: 265 LSLNIDVSTTMIVKPGPVIDFLLANQKVDHP 295 >03_03_0158 - 14951504-14951568,14952722-14952797,14952876-14952943, 14952997-14953156,14953239-14953425,14953982-14953986 Length = 186 Score = 27.9 bits (59), Expect = 3.3 Identities = 9/14 (64%), Positives = 14/14 (100%) Frame = +3 Query: 267 WLKVDFNRWQDEDE 308 +LKVD+++WQDED+ Sbjct: 100 FLKVDWDKWQDEDD 113 >01_03_0003 + 11509530-11512772 Length = 1080 Score = 27.9 bits (59), Expect = 3.3 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 113 FFSGSHIP-LNVIDLGSMFISGFSHSTLNVKKIR 15 FF+ H+ L V++LGS +S HS N+K++R Sbjct: 608 FFTKPHMRFLRVLELGSCRLSELPHSVGNLKQLR 641 >11_06_0473 - 23992243-23992542,23993737-23993796 Length = 119 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 297 DEDESGDDLDNMNDMFSDKDMNIQFGGDNEKDDSSS 404 D D+ +D D +NDM + + + G D++K +S S Sbjct: 59 DFDDETEDFDFLNDMSTYAETKVPQGEDSDKLESDS 94 >09_06_0241 + 21803476-21803604,21804968-21805026,21805117-21805444 Length = 171 Score = 27.5 bits (58), Expect = 4.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 303 DESGDDLDNMNDMFSDKDMNIQFGGDNEKDDSSSG 407 DE G+D D+ +D D + N G D+E DD G Sbjct: 109 DEGGEDEDDDDD---DPEANGDGGSDDEDDDDDDG 140 >09_04_0500 - 18120287-18122233 Length = 648 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 294 QDEDESGDDLDNMNDMFSDKDMNIQ 368 ++ED+ GD+ D+ DMF D N++ Sbjct: 507 EEEDDDGDEEDDDEDMFKDDAGNLK 531 >08_02_0911 + 22530370-22530497,22531083-22531126,22531224-22531267, 22531428-22531946,22532032-22532257,22532336-22532662, 22532915-22533165,22533374-22534072 Length = 745 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 297 DEDESGDDLDNMNDMFSDKDMNIQFGGDNEKDDSSS 404 D D+ D+LD NDM + + G D++K ++ S Sbjct: 552 DFDDEADELDTFNDMSTYAETKYPQGEDSDKLEADS 587 >01_01_1197 - 9630506-9630681,9630774-9630805,9630894-9630988, 9631569-9631642,9631732-9631843,9631967-9632030, 9632210-9632275,9632396-9632526,9632884-9633021, 9633115-9633227,9633306-9633471,9633588-9633701, 9633791-9633853,9633953-9634060,9634143-9634259, 9634343-9634505,9634646-9634743,9634852-9634949, 9635054-9635190,9635309-9635530,9635625-9635830, 9636758-9636845,9638085-9638668 Length = 1054 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 136 LYAEVDPKKSMWVNKGRLIEVLLAKEKVDEP 228 L +D +M V G +++ LLA +KVD P Sbjct: 408 LSLNIDVSTTMIVKPGPVVDFLLANQKVDHP 438 >09_06_0199 + 21526872-21527250,21527431-21527594,21527673-21527736, 21528001-21528134,21528302-21528385,21528526-21528600, 21528683-21528754,21528852-21528925,21529185-21529282, 21529355-21529464,21529794-21529862,21529944-21530018, 21530519-21530611,21530690-21530769,21530877-21530976, 21531150-21531586,21531676-21531706,21532873-21533822, 21533982-21534201 Length = 1102 Score = 27.1 bits (57), Expect = 5.7 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 6/39 (15%) Frame = +3 Query: 297 DEDESGDDLDNMNDM----FSDKDMNIQFGGD--NEKDD 395 +EDESG DLD +D SD D GGD +E+DD Sbjct: 63 EEDESGSDLDAPSDSGAEELSDSDDASLEGGDSGDEEDD 101 >08_01_0626 - 5445676-5446687,5447099-5447430 Length = 447 Score = 27.1 bits (57), Expect = 5.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 294 QDEDESGDDLDNMNDMFSDKDMN 362 +DEDE+ DD D +M D+D++ Sbjct: 236 EDEDENNDDDDEEEEMEEDEDLD 258 >01_01_0652 + 4975091-4975585 Length = 164 Score = 27.1 bits (57), Expect = 5.7 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 288 RWQDE-DESGDDLDNMNDMFSDKDMNIQFGGDNEKDD 395 RW+ D+ DDLD+ +D D D++ GG ++ DD Sbjct: 62 RWEAALDDPDDDLDDPDDDLDD-DLDDDDGGPDDLDD 97 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,511,524 Number of Sequences: 37544 Number of extensions: 187507 Number of successful extensions: 657 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 718652880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -