BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20803 (371 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC026012-1|AAH26012.1| 211|Homo sapiens C6orf128 protein protein. 29 3.6 AL353579-2|CAI20317.1| 211|Homo sapiens protein ( Human DNA seq... 29 3.6 AK098666-1|BAC05371.1| 229|Homo sapiens protein ( Homo sapiens ... 29 3.6 AK023542-1|BAB14603.1| 127|Homo sapiens protein ( Homo sapiens ... 29 4.8 >BC026012-1|AAH26012.1| 211|Homo sapiens C6orf128 protein protein. Length = 211 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/47 (27%), Positives = 32/47 (68%), Gaps = 2/47 (4%) Frame = -3 Query: 285 LILAVSFLLVVLWCFKIFLIFSITFR-FLIYI-YKFFVDFSYLLLDI 151 ++L +SF+ +++ CF ++ +++ FR +IYI + FF + + +++ I Sbjct: 67 IVLFLSFITILISCFLLYSVYAQIFRGLVIYIVWIFFYETANVVIQI 113 >AL353579-2|CAI20317.1| 211|Homo sapiens protein ( Human DNA sequence from clone RP3-355M6 on chromosome 6 Contains thePIM1 gene for pim-1 oncogene (PIM), a novel gene, the 5' end of the asin A2 pim-1 oncogene). Length = 211 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/47 (27%), Positives = 32/47 (68%), Gaps = 2/47 (4%) Frame = -3 Query: 285 LILAVSFLLVVLWCFKIFLIFSITFR-FLIYI-YKFFVDFSYLLLDI 151 ++L +SF+ +++ CF ++ +++ FR +IYI + FF + + +++ I Sbjct: 67 IVLFLSFITILISCFLLYSVYAQIFRGLVIYIVWIFFYETANVVIQI 113 >AK098666-1|BAC05371.1| 229|Homo sapiens protein ( Homo sapiens cDNA FLJ25800 fis, clone TST07092. ). Length = 229 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/47 (27%), Positives = 32/47 (68%), Gaps = 2/47 (4%) Frame = -3 Query: 285 LILAVSFLLVVLWCFKIFLIFSITFR-FLIYI-YKFFVDFSYLLLDI 151 ++L +SF+ +++ CF ++ +++ FR +IYI + FF + + +++ I Sbjct: 67 IVLFLSFITILISCFLLYSVYAQIFRGLVIYIVWIFFYETANVVIQI 113 >AK023542-1|BAB14603.1| 127|Homo sapiens protein ( Homo sapiens cDNA FLJ13480 fis, clone PLACE1003768. ). Length = 127 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 240 KIFLIFSITFRFLIYIYKFFVDFSYL 163 KIF +F I F F++ +FFV F Y+ Sbjct: 16 KIFSLFKIGFFFIVEFKEFFVYFGYM 41 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,297,656 Number of Sequences: 237096 Number of extensions: 496404 Number of successful extensions: 1472 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1472 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2421480012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -