BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20799 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34115| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 3.6 SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18) 28 8.4 >SB_34115| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1572 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = -2 Query: 508 KCTNVGKRNKAVGRIFSGSPKKSTEKISVNDHHFTEITFHPISSNLISFNF 356 + T+VG R+ + + F + + KIS N HF I + +S +ISF F Sbjct: 1392 RSTSVGPRHFNIAKTFLKTLVERM-KISTNGSHFGLIAYSSSASRVISFRF 1441 >SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18) Length = 1764 Score = 27.9 bits (59), Expect = 8.4 Identities = 19/40 (47%), Positives = 23/40 (57%) Frame = -3 Query: 492 ENETKPLGVSSRDPPKSPLKKSQ*MTTILLRLHFIPYHLI 373 EN L SSR PP+ PL S+ L +LH +PYHLI Sbjct: 859 ENSLGHLVRSSRVPPQ-PLMLSRHQYN-LRKLHELPYHLI 896 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,183,548 Number of Sequences: 59808 Number of extensions: 391899 Number of successful extensions: 808 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -