Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20799
         (698 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g46860.1 68415.m05847 inorganic pyrophosphatase, putative [so...    29   3.9  

>At2g46860.1 68415.m05847 inorganic pyrophosphatase, putative
           [soluble] / pyrophosphate phospho-hydrolase, putative /
           PPase, putative strong similarity to SP|Q43187 Soluble
           inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate
           phospho- hydrolase) (PPase) {Solanum tuberosum};
           contains Pfam profile PF00719: inorganic pyrophosphatase
          Length = 216

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 2/41 (4%)
 Frame = +3

Query: 492 PTLVHFTDIKQLVNHRYYTFKP--EETLNRQNKTIHTTSLL 608
           P   HFTDIKQL  HR    +   E+    +NK +     L
Sbjct: 150 PEYKHFTDIKQLAPHRLQEIRRFFEDYKKNENKKVAVNDFL 190


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,309,292
Number of Sequences: 28952
Number of extensions: 281588
Number of successful extensions: 615
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 604
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 615
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1496852856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)