BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20790 (405 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 27 0.11 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 4.0 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 7.0 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 7.0 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 7.0 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 7.0 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 7.0 >AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family protein protein. Length = 166 Score = 26.6 bits (56), Expect = 0.11 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 6/98 (6%) Frame = +1 Query: 40 VFAMCMLAASAGVVELSADTSNQDLEEKLYNS----ILTGDYDXAXRQSLEYESQGKGSI 207 +FA CM ++ +++ D + + L S I++ D+D + EY + + Sbjct: 37 LFARCMGGINSRNMDIEHDPGLAAVLQYLIRSGQLNIISSDHDDSDE---EYAANSQPPR 93 Query: 208 IQNVVNNLIIDKRRNTWSTATSCG--SXTDRKLLESTS 315 I +V N +DK + +T +CG D++ L TS Sbjct: 94 ITSVPNTSRLDKSEISLATKQACGFIDNIDKRNLSVTS 131 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 4.0 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 92 ADSSTTPALAASMHIANTTRSFI 24 A+ + +A +HI+N T SF+ Sbjct: 396 ANKMESSGMAGRVHISNATLSFL 418 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 20.6 bits (41), Expect = 7.0 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -2 Query: 305 SNNFLSVXDPQLVAVLHVFRLLSMIRLL 222 S +F + + + +L + +LLS++RLL Sbjct: 193 SESFQILHAGRALRILRLAKLLSLVRLL 220 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 20.6 bits (41), Expect = 7.0 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -2 Query: 305 SNNFLSVXDPQLVAVLHVFRLLSMIRLL 222 S +F + + + +L + +LLS++RLL Sbjct: 193 SESFQILHAGRALRILRLAKLLSLVRLL 220 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 20.6 bits (41), Expect = 7.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 104 LEVSADSSTTPALAASMHIANTTRSFIL 21 LE S S +P + +NT+++FIL Sbjct: 80 LERSKTKSKSPESRDRSNTSNTSKTFIL 107 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 20.6 bits (41), Expect = 7.0 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -2 Query: 305 SNNFLSVXDPQLVAVLHVFRLLSMIRLL 222 S +F + + + +L + +LLS++RLL Sbjct: 193 SESFQILHAGRALRILRLAKLLSLVRLL 220 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 20.6 bits (41), Expect = 7.0 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -1 Query: 135 AVVQFLLEVLVRSVRG*FNDARAGGEHAHRKYN 37 A V+ ++V++ + G NDA G YN Sbjct: 107 AGVRIYVDVIMNHMSGDRNDAHGTGNSRANTYN 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,935 Number of Sequences: 438 Number of extensions: 1969 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10132494 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -