BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20788 (411 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110498-7|CAB57909.2| 302|Caenorhabditis elegans Hypothetical ... 33 0.11 Z81093-1|CAB03148.2| 507|Caenorhabditis elegans Hypothetical pr... 28 2.3 X98601-1|CAA67198.1| 507|Caenorhabditis elegans non-alpha nicot... 28 2.3 X98246-1|CAA66902.1| 507|Caenorhabditis elegans nicotinic acety... 28 2.3 Z30317-5|CAA82971.4| 1890|Caenorhabditis elegans Hypothetical pr... 26 9.2 U80023-9|AAG24041.1| 257|Caenorhabditis elegans Hypothetical pr... 26 9.2 >AL110498-7|CAB57909.2| 302|Caenorhabditis elegans Hypothetical protein Y64G10A.1 protein. Length = 302 Score = 32.7 bits (71), Expect = 0.11 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +2 Query: 50 CACSPPARASLNYPRTLLTKTSRRNCTTASSPATTTVLSVRAWNMRAKARAP 205 CA + A ++LNY RT L+ +NC P TT + + A N + AP Sbjct: 38 CATTCGACSNLNYTRTCLSD-GLKNCACVGEPTTTMLCNTIACNYPRGSEAP 88 >Z81093-1|CAB03148.2| 507|Caenorhabditis elegans Hypothetical protein F09E8.7 protein. Length = 507 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +3 Query: 108 RPRGETVQQHPHRRLRQCCPSELGI*EPRQGLHHPEC 218 RP + V Q HRRL + PS + R G HHP C Sbjct: 355 RPHRKNVIQRSHRRLLETGPS-VEENPMRSGEHHPLC 390 >X98601-1|CAA67198.1| 507|Caenorhabditis elegans non-alpha nicotinic acetylcholinereceptor subunit protein. Length = 507 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +3 Query: 108 RPRGETVQQHPHRRLRQCCPSELGI*EPRQGLHHPEC 218 RP + V Q HRRL + PS + R G HHP C Sbjct: 355 RPHRKNVIQRSHRRLLETGPS-VEENPMRSGEHHPLC 390 >X98246-1|CAA66902.1| 507|Caenorhabditis elegans nicotinic acetylcholine receptor protein. Length = 507 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +3 Query: 108 RPRGETVQQHPHRRLRQCCPSELGI*EPRQGLHHPEC 218 RP + V Q HRRL + PS + R G HHP C Sbjct: 355 RPHRKNVIQRSHRRLLETGPS-VEENPMRSGEHHPLC 390 >Z30317-5|CAA82971.4| 1890|Caenorhabditis elegans Hypothetical protein T16G12.1 protein. Length = 1890 Score = 26.2 bits (55), Expect = 9.2 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +1 Query: 103 NQDLEEKLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNN 228 N DL++ + SIL+GDY ++ S+ + +++N Sbjct: 1764 NLDLQKTMLRSILSGDYPPSLLNSIAVHDDSSDVLYNFLLDN 1805 >U80023-9|AAG24041.1| 257|Caenorhabditis elegans Hypothetical protein F07C4.10 protein. Length = 257 Score = 26.2 bits (55), Expect = 9.2 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 349 SFLAMMSLKFNGKYFLTISCPLPTHSL*QYSMCSVSC 239 SFL ++ K NG Y + S T + +YS +VSC Sbjct: 12 SFLNSVNGKVNGDYNCSYSVTFSTPDVWRYSPSAVSC 48 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,893,316 Number of Sequences: 27780 Number of extensions: 173519 Number of successful extensions: 530 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 662437636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -