BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20785 (718 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 25 1.8 AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against p... 23 7.2 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 25.4 bits (53), Expect = 1.8 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 6/37 (16%) Frame = -1 Query: 403 TRNRR------NGPSIYDIPTLGTRFIMMFYMYDTED 311 TRNRR GP +DIP + M +Y + E+ Sbjct: 133 TRNRRFFPNGPEGPDSFDIPMMAKSHCMPYYFWQEEN 169 >AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against programmed cell death protein. Length = 112 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +2 Query: 35 MKVIFLILLYCFTLLIDCL*YCTVVTIVTFFDFLKRIL*IIFCF 166 +K++ LLY I YC +V F FL + + CF Sbjct: 23 LKIVDAYLLYILLTGIMQFVYCCLVGTFPFNSFLAGFISTVSCF 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 626,012 Number of Sequences: 2352 Number of extensions: 10879 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -