BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20781 (522 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16C6.06 |pep1|vps10|sorting receptor for CPY|Schizosaccharom... 26 3.9 SPAC22F3.12c |rgs1||regulator of G-protein signaling Rgs1|Schizo... 25 5.2 SPAC27D7.14c |tpr1|SPAC637.02c|RNA polymerase II associated Paf1... 25 6.8 SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomy... 25 6.8 >SPBC16C6.06 |pep1|vps10|sorting receptor for CPY|Schizosaccharomyces pombe|chr 2|||Manual Length = 1466 Score = 25.8 bits (54), Expect = 3.9 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 410 TVLNKNEFLTGISNPNEEYFSEEK 481 TV +N FL GIS + YFSE++ Sbjct: 720 TVPEENTFLIGISVNSHVYFSEDE 743 >SPAC22F3.12c |rgs1||regulator of G-protein signaling Rgs1|Schizosaccharomyces pombe|chr 1|||Manual Length = 481 Score = 25.4 bits (53), Expect = 5.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 410 TVLNKNEFLTGISNPNEEYFSEEKCLIKFRLNVY 511 T LN L ++NP+ FS EKCL++ Y Sbjct: 127 TFLNAR-LLQIVNNPSARKFSNEKCLLQLTRKGY 159 >SPAC27D7.14c |tpr1|SPAC637.02c|RNA polymerase II associated Paf1 complex subunit Tpr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1039 Score = 25.0 bits (52), Expect = 6.8 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 368 YF*LCQKYPS*ISFTVLNKNEFLTGISNPNEEYFSE 475 Y + +K+PS I + + L +SNPNEE F E Sbjct: 537 YVSILEKHPSFIDARI---RKCLLQLSNPNEETFKE 569 >SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomyces pombe|chr 2|||Manual Length = 1142 Score = 25.0 bits (52), Expect = 6.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 297 RFTMFSNIK*FFTEEILINFYFLNNQILYYLYNFIVN 187 R + F++ F E+ L+NF F N +YN + N Sbjct: 475 RLSQFASQSPLFREQFLLNFDFTYNLSESEVYNTVFN 511 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,826,912 Number of Sequences: 5004 Number of extensions: 33362 Number of successful extensions: 82 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -