BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20781 (522 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0371 + 22615809-22617431,22618312-22618422,22619361-226194... 27 6.9 03_02_0849 - 11768191-11771412 27 9.1 >09_06_0371 + 22615809-22617431,22618312-22618422,22619361-22619453, 22619562-22619661,22619754-22619834,22620774-22621047, 22621254-22622069,22622921-22623029,22623509-22623602, 22623881-22623939,22624150-22624197 Length = 1135 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = -1 Query: 261 TEEILINFYFLNNQILYYLYNFIVNPYLINYSQ*GSEISILSLEIML 121 +E + +N Y N + + LY FI NP I G I +++ +M+ Sbjct: 684 SESLRVN-YISNKDMRFGLYEFIFNPQCIPCHASGDFIIVVTTRVMI 729 >03_02_0849 - 11768191-11771412 Length = 1073 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 257 SVKNHFMLLNIVNRQTITTLNFIYHSNKYFATKFLKQYF*LCQKYP 394 ++ N +LN N + + +L YH Y LKQ F LC +P Sbjct: 397 NISNQMRILNEDNNRILPSLQISYHHLPY----HLKQLFTLCCLFP 438 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,552,662 Number of Sequences: 37544 Number of extensions: 145782 Number of successful extensions: 203 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 203 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -