BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20777X (365 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0190 - 23442824-23442846,23442891-23442949,23443613-234437... 29 1.5 12_01_0378 - 2946916-2947590 28 2.0 06_01_0605 + 4373697-4373872,4374840-4374876,4375296-4375399,437... 28 2.0 03_06_0460 - 34098115-34098622,34098981-34099355,34100939-341011... 27 3.4 08_02_0647 - 19687142-19687145,19687244-19689352,19689764-19690617 27 4.5 06_03_0095 - 16575938-16576585,16577028-16577219,16577294-165773... 27 4.5 03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838,235... 27 4.5 10_08_0589 + 19022233-19022457,19022578-19022709,19023129-190232... 27 6.0 08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366... 27 6.0 01_02_0118 + 11271020-11271293,11272849-11273145,11273226-112734... 27 6.0 12_01_0677 - 5774633-5774645,5774713-5775062 26 7.9 03_02_0054 + 5292167-5292336,5292434-5292526,5292828-5293003,529... 26 7.9 >04_04_0190 - 23442824-23442846,23442891-23442949,23443613-23443737, 23443767-23443901,23444195-23444301,23444488-23444566, 23444856-23444942,23445045-23445281,23445783-23446128, 23446486-23446694 Length = 468 Score = 28.7 bits (61), Expect = 1.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 315 TQLGNNPGRCPWSPGAKVDRLLHAVHLVVSYQF 217 T G P CP S AKV+ HLV++Y++ Sbjct: 411 TPFGGGPRLCPGSELAKVEAAFFLHHLVLNYRW 443 >12_01_0378 - 2946916-2947590 Length = 224 Score = 28.3 bits (60), Expect = 2.0 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +1 Query: 7 GLDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYD 147 G+ ++P +++L ASL AA++ VP + ++ +VV D+D Sbjct: 87 GVHYDAIRPRLLLLLAGGASLGAANATVPGVFHQPRMSTTVVAIDFD 133 >06_01_0605 + 4373697-4373872,4374840-4374876,4375296-4375399, 4375942-4376137,4376385-4376451,4376895-4376998, 4377090-4377174,4377309-4377369,4377694-4377825, 4377924-4377993,4379261-4379413,4379583-4379694, 4379779-4379920,4380023-4380140,4380862-4380957, 4381061-4381189 Length = 593 Score = 28.3 bits (60), Expect = 2.0 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +1 Query: 190 SEVITNVVNKLIRNN--KMNCME*PINFGSRAPRTSSGIVSQLSSDLSSPKTRLSLCTS 360 SE I+++ N+L R+ K+ C N S A I S+L S LS+ TRL CTS Sbjct: 343 SEFISHLANQLARHQFLKIACQLERKNIAS-AYSLLRVIESELQSYLSAVNTRLGHCTS 400 >03_06_0460 - 34098115-34098622,34098981-34099355,34100939-34101156, 34101235-34101297 Length = 387 Score = 27.5 bits (58), Expect = 3.4 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -1 Query: 95 LGTSESAAYRDATKRHRITIAGFIFGAS 12 +G +++A+Y +T R + +AG + GAS Sbjct: 284 VGAADAASYCGSTSRRMVQVAGEVLGAS 311 >08_02_0647 - 19687142-19687145,19687244-19689352,19689764-19690617 Length = 988 Score = 27.1 bits (57), Expect = 4.5 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +1 Query: 97 DILEEQLYNSVVVADY--DSAVEKSKHLYEEKKSEVITNVVNKLIRNNK 237 DIL E LY S ++DY D ++L + + + N++ + ++NN+ Sbjct: 237 DILSEVLYTSNPMSDYQKDHFWRIKENLNQPLEDHQLINMIKEYLKNNR 285 >06_03_0095 - 16575938-16576585,16577028-16577219,16577294-16577392, 16577496-16577618,16577717-16577929,16578143-16578251, 16578339-16578427,16578604-16578880,16578974-16579084, 16579160-16580508,16581218-16581631 Length = 1207 Score = 27.1 bits (57), Expect = 4.5 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 308 WETIPDDVLGALEPKLIGYSMQFILLFRISLFTTFVMTSLFFS 180 W PDD +PK + F LL + L++ F+ SL+ S Sbjct: 344 WYLRPDDSTIFYDPKRAALASFFHLLTALMLYSYFIPISLYIS 386 >03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838, 2353031-2353708,2353800-2353964,2354139-2354433, 2354581-2354795,2354885-2355190,2355269-2355332, 2355426-2355665,2355783-2355886 Length = 1505 Score = 27.1 bits (57), Expect = 4.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +2 Query: 56 SWHLCMLQIPTSLTTFWRSSFTIASSSPITTV 151 +W + +L +P ++ W + IASS +T + Sbjct: 1080 TWQVLILIVPMAVACMWMQRYYIASSRELTRI 1111 >10_08_0589 + 19022233-19022457,19022578-19022709,19023129-19023227, 19023384-19023431,19023926-19023976,19024205-19024273, 19024337-19024419,19024643-19024766,19024843-19024902, 19024983-19025225,19025426-19025509,19025581-19025728, 19025909-19025986,19025987-19026114,19026204-19026251, 19026922-19027052,19027708-19027817,19028365-19028468, 19028614-19028684,19029091-19029389,19029507-19029682 Length = 836 Score = 26.6 bits (56), Expect = 6.0 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = +1 Query: 34 AIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVV 213 AIV L LFV SL D+D+ N L + + +S + Y V+ + + +++ N Sbjct: 140 AIVSLMLFVESLQILDADI-NKSLVKSIQDSPELRRYREQVQVLESRLYQLMDKLVRNAD 198 Query: 214 NK 219 N+ Sbjct: 199 NE 200 >08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870, 3661975-3662133,3662193-3662243,3662838-3663018, 3663102-3663228,3663322-3663431,3663529-3663667, 3663767-3663876,3664002-3664071,3664247-3664320, 3664458-3664553,3664682-3664777,3665041-3665168, 3665422-3665656,3665743-3665910,3666274-3666381, 3666468-3666617,3666905-3667015,3667118-3667297, 3667427-3667555,3667819-3667914,3668108-3668293, 3668431-3668603,3668720-3668921 Length = 1150 Score = 26.6 bits (56), Expect = 6.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 291 RCPWSPGAKVDRLLHAVHLVVSYQFV 214 RC WSP + + + H+V +Y FV Sbjct: 430 RCLWSPDGSILGVAFSKHIVQTYAFV 455 >01_02_0118 + 11271020-11271293,11272849-11273145,11273226-11273439, 11273563-11273672,11273746-11273945,11274439-11274501, 11274560-11274663,11274868-11275055,11275129-11275328, 11275463-11275693 Length = 626 Score = 26.6 bits (56), Expect = 6.0 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = +3 Query: 252 VAYQLWLQGSKDIVRDCFPVEFRLIFAEN---AIKLMYKR 362 V Y +W+ G +VRD + + R ++ +N AI Y+R Sbjct: 399 VRYSIWIDGKLKLVRDPYQLLERFLWRKNVSFAISRHYRR 438 >12_01_0677 - 5774633-5774645,5774713-5775062 Length = 120 Score = 26.2 bits (55), Expect = 7.9 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +3 Query: 159 KEQAFIRGEEERSHHKCREQTDTKQQDELHGVAYQLWLQGSKDIVRDC-FPVEFRLIFAE 335 +EQ RG HH REQ ++Q + + G D C F E L+ A Sbjct: 7 REQQMQRGGRHHQHHTTREQEQQQKQQQRRRLMNNATNGGGGDGGSRCYFSTEAILVLAC 66 Query: 336 NAIKLM 353 + L+ Sbjct: 67 VTVSLL 72 >03_02_0054 + 5292167-5292336,5292434-5292526,5292828-5293003, 5293076-5293122,5293732-5293801,5293960-5294186, 5294274-5294327,5294470-5294545,5294679-5294884 Length = 372 Score = 26.2 bits (55), Expect = 7.9 Identities = 22/69 (31%), Positives = 29/69 (42%), Gaps = 8/69 (11%) Frame = +1 Query: 1 HTGLDAPKMKPAIVILCLFVASLYAA------DSDVPNDI--LEEQLYNSVVVADYDSAV 156 H+ L PK A L VASL A + ++P +I LEE + Sbjct: 196 HSDLHEPKFSRAFECLSTMVASLEPAVVDSVYEEEIPGNISFLEENYSKAKFYLRLKRRN 255 Query: 157 EKSKHLYEE 183 + KHLYEE Sbjct: 256 GRVKHLYEE 264 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,170,691 Number of Sequences: 37544 Number of extensions: 156776 Number of successful extensions: 525 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 525 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 564709324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -