BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20777X (365 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 33 0.044 At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase f... 29 0.72 At1g59453.1 68414.m06679 transcription factor-related weak simil... 27 2.9 At1g59077.1 68414.m06670 hypothetical protein 27 2.9 At1g58766.1 68414.m06659 hypothetical protein 27 2.9 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 27 2.9 At2g04620.1 68415.m00470 cation efflux family protein potential ... 27 3.8 At5g58860.1 68418.m07375 cytochrome P450 86A1 (CYP86) (CYP86A1) ... 27 5.0 At5g47690.1 68418.m05887 expressed protein 27 5.0 At4g28590.1 68417.m04089 expressed protein 27 5.0 At4g17080.1 68417.m02574 MORN (Membrane Occupation and Recogniti... 27 5.0 At3g30550.1 68416.m03866 hypothetical protein includes At2g05890... 27 5.0 At4g36490.1 68417.m05181 SEC14 cytosolic factor, putative / phos... 26 6.7 At1g70400.1 68414.m08098 hypothetical protein similar to U4/U6 s... 26 6.7 At4g09870.1 68417.m01616 F-box family protein contains Pfam PF00... 26 8.8 At3g23010.1 68416.m02901 disease resistance family protein / LRR... 26 8.8 At3g09130.1 68416.m01074 hypothetical protein 26 8.8 At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF... 26 8.8 At1g15320.1 68414.m01833 hypothetical protein 26 8.8 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 33.5 bits (73), Expect = 0.044 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +1 Query: 10 LDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKK 189 +D + P+ +I+ + V +L S +P D+L++ L D DSA +K E K Sbjct: 154 VDLADLLPSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESKM 213 Query: 190 SEVITNV 210 + N+ Sbjct: 214 GSIAPNL 220 >At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase family protein contains Pfam profile PF01812 5-formyltetrahydrofolate cyclo-ligase Length = 354 Score = 29.5 bits (63), Expect = 0.72 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 280 PRTSSGIVSQLSSDLSSPKTRLSLCTS 360 PR +G S L SDL P+T + CTS Sbjct: 171 PRLRTGFFSVLESDLLKPETIMEACTS 197 >At1g59453.1 68414.m06679 transcription factor-related weak similarity to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362 Length = 1729 Score = 27.5 bits (58), Expect = 2.9 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 103 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 210 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 1545 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 1581 >At1g59077.1 68414.m06670 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 2.9 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 103 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 210 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g58766.1 68414.m06659 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 2.9 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 103 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 210 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 27.5 bits (58), Expect = 2.9 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = +2 Query: 56 SWHLCMLQIPTSLTTFWRSSFTIASSSPITTV 151 +W + +L +P ++ FW + +ASS + + Sbjct: 1086 TWQVFLLVVPVAVACFWMQKYYMASSRELVRI 1117 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.1 bits (57), Expect = 3.8 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -3 Query: 120 VKLLLQNVVRDVGICSIQRCH 58 +K ++N+++ G+CSIQR H Sbjct: 727 LKEAMRNILKTKGVCSIQRLH 747 >At5g58860.1 68418.m07375 cytochrome P450 86A1 (CYP86) (CYP86A1) / CYPLXXXVI / P450-dependent fatty acid omega-hydroxylase identical to Cytochrome P450 86A1 (CYPLXXXVI) (P450-dependent fatty acid omega-hydroxylase) (SP:P48422) [Arabidopsis thaliana] Length = 513 Score = 26.6 bits (56), Expect = 5.0 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +1 Query: 10 LDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLY-EEK 186 +DA K P+ +L F+ + +P D+L+ N V+ S+V S + Sbjct: 262 IDARKNSPSDDLLSRFLKKRDVNGNVLPTDVLQRIALNFVLAGRDTSSVALSWFFWLVMN 321 Query: 187 KSEVITNVVNKL 222 EV T +VN+L Sbjct: 322 NREVETKIVNEL 333 >At5g47690.1 68418.m05887 expressed protein Length = 1638 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/44 (25%), Positives = 26/44 (59%) Frame = +1 Query: 97 DILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIR 228 D+LE++ Y V+ + + +YE ++SEV+ + +K+++ Sbjct: 734 DMLEDKRYQPAVLQCLGCIAQIAMPVYETRESEVVEFIRSKILK 777 >At4g28590.1 68417.m04089 expressed protein Length = 331 Score = 26.6 bits (56), Expect = 5.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 353 HKLNRVFGEDKSELNWETIPDD 288 H + V G+D SE++WE DD Sbjct: 180 HPIKNVVGDDGSEIDWEGEIDD 201 >At4g17080.1 68417.m02574 MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein /phosphatidylinositol-4-phosphate 5-kinase-related low similarity to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profile PF02493: MORN repeat Length = 471 Score = 26.6 bits (56), Expect = 5.0 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +2 Query: 59 WHLCMLQIPTSLTTFWRSSFTIASSSPITTVRLKRASIYTRRRRAK 196 W +L PT TT SSF+I+ S + TV+ R + R K Sbjct: 385 WEDGVLNCPTEQTTRPDSSFSISHSKVVDTVQQARKAAKKAREVVK 430 >At3g30550.1 68416.m03866 hypothetical protein includes At2g05890, At4g07450, At3g30630, At3g43100, At2g09960, At3g30550, At1g39430, At2g10460, At4g03640, At5g35250 Length = 509 Score = 26.6 bits (56), Expect = 5.0 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +1 Query: 43 ILCLFVASLYAA-DSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVN 216 +LC+ +++ DS + + + + +V DYD+ V+ S + E+ S ++TN V+ Sbjct: 405 LLCVQRENIFGGYDSFTVARVYTDNIADEIVQEDYDAYVDPSSLISIEQDSLMLTNGVD 463 >At4g36490.1 68417.m05181 SEC14 cytosolic factor, putative / phosphoglyceride transfer protein, putative similar to phosphatidylinositol transfer-like protein IV (GI:14486707) [Lotus japonicus]; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus; supporting cDNA gi|23463078|gb|BT000834.1| Length = 543 Score = 26.2 bits (55), Expect = 6.7 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +1 Query: 37 IVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKS 165 ++ L + V ++ +VP + E LY+S V D D+++ KS Sbjct: 405 VMALVMGVVTMIKVTKNVPRKLTESTLYSSPVYCD-DASMNKS 446 >At1g70400.1 68414.m08098 hypothetical protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847 Length = 168 Score = 26.2 bits (55), Expect = 6.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +1 Query: 10 LDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEK 162 +D + P+ +I+ L V +L + +P D+L + + D DSA +K Sbjct: 104 VDLEGLLPSAMIMVLLVTALTTKGNQLPEDVLLKTIDACDRALDLDSARKK 154 >At4g09870.1 68417.m01616 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box protein interaction domain; hypothetical protein T25N22.10 -Arabidopsis thaliana, PID:g3805763 Length = 337 Score = 25.8 bits (54), Expect = 8.8 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +2 Query: 140 ITTVRLKRASIYTRRRRAKSSQMS*TN*Y-ETTR*TAWSSLSTLAPGLQGHRPGL 301 ++ VR ++ S+ + R ++ TN ETT+ +WS + TL G+ PGL Sbjct: 203 LSVVREEKLSVLLQLRGTSRKEIWVTNKINETTQVLSWSKVLTLDNSDFGYCPGL 257 >At3g23010.1 68416.m02901 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 595 Score = 25.8 bits (54), Expect = 8.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 262 NFGSRAPRTSSGIVSQLSSDLSSPK 336 NFG + PR+ S +V+ S DLS K Sbjct: 151 NFGGQVPRSISKVVNLTSVDLSYNK 175 >At3g09130.1 68416.m01074 hypothetical protein Length = 397 Score = 25.8 bits (54), Expect = 8.8 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +1 Query: 88 VPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKM 240 V ND++EE++ + + YD K+ + K E ++ +N NK+ Sbjct: 103 VENDLIEEEMDTAKLAVGYDGETIVIKNDVDSKWKEELSKPLNLSETENKV 153 >At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF) identical to alpha-glucosidase I (GI:16506680, GI:13398928) [Arabidopsis thaliana] Length = 852 Score = 25.8 bits (54), Expect = 8.8 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +1 Query: 100 ILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVV 213 IL + S+V Y EKSK +Y E +S +I NVV Sbjct: 774 ILSSLYHYSIVDGPYR---EKSKAIYTELRSNLIRNVV 808 >At1g15320.1 68414.m01833 hypothetical protein Length = 307 Score = 25.8 bits (54), Expect = 8.8 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 177 RGEEERSHHKCREQTDTKQQDELHGVAYQLWLQGSKDI 290 R ERSH + ++ TK DEL G Y+LW Q I Sbjct: 58 RSHAERSH---QHESFTKG-DELSGDLYELWRQEQNSI 91 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,364,489 Number of Sequences: 28952 Number of extensions: 127682 Number of successful extensions: 543 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 477939072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -