BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20773 (657 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39660.1 68417.m05608 alanine--glyoxylate aminotransferase, p... 38 0.004 At3g08860.1 68416.m01030 alanine--glyoxylate aminotransferase, p... 36 0.031 At3g22200.1 68416.m02801 4-aminobutyrate aminotransferase / gamm... 34 0.096 At2g38400.1 68415.m04717 alanine--glyoxylate aminotransferase, p... 32 0.29 At5g27610.1 68418.m03308 myb family transcription factor contain... 28 4.8 >At4g39660.1 68417.m05608 alanine--glyoxylate aminotransferase, putative / beta-alanine-pyruvate aminotransferase, putative / AGT, putative similar to SP|Q64565 Alanine--glyoxylate aminotransferase 2, mitochondrial precursor (EC 2.6.1.44) (AGT 2) (Beta-alanine-pyruvate aminotransferase) {Rattus norvegicus}; contains Pfam profile PF00202: aminotransferase, class III Length = 476 Score = 38.3 bits (85), Expect = 0.004 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +1 Query: 385 YFFDADGNAFLDAFTQISSLPVGYNHPELLSAFEDQHNL 501 Y +D G +LDAF I ++ G+ HP++L+A +Q L Sbjct: 88 YLYDESGRRYLDAFAGIVTVSCGHCHPDILNAITEQSKL 126 >At3g08860.1 68416.m01030 alanine--glyoxylate aminotransferase, putative / beta-alanine-pyruvate aminotransferase, putative / AGT, putative similar to similar to SP|Q64565 Alanine--glyoxylate aminotransferase 2, mitochondrial precursor (EC 2.6.1.44) (AGT 2) (Beta-alanine-pyruvate aminotransferase) {Rattus norvegicus}; contains Pfam profile PF00202: aminotransferase, class III Length = 481 Score = 35.5 bits (78), Expect = 0.031 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +1 Query: 385 YFFDADGNAFLDAFTQISSLPVGYNHPELLSAFEDQHNL 501 Y FD +G +LDAF I+++ G+ HPE++++ Q L Sbjct: 93 YVFDENGRRYLDAFGGIATVSCGHCHPEVVNSVVKQLKL 131 >At3g22200.1 68416.m02801 4-aminobutyrate aminotransferase / gamma-amino-N-butyrate transaminase / GABA transaminase / beta-alanine--oxoglutarate aminotransferase identical to gamma-aminobutyrate transaminase subunit precursor [Arabidopsis thaliana] (EC 2.6.1.19) GI:14030435; contains Pfam profile PF00202: aminotransferase, class III; identical to cDNA gamma-aminobutyrate transaminase subunit precursor, nuclear gene for mitochondrial product GI:14030434 Length = 504 Score = 33.9 bits (74), Expect = 0.096 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +1 Query: 370 KSIGNYFFDADGNAFLDAFTQISSLPVGYNHPELLSAFEDQHN 498 KS G+Y +D G +LD+ + +G N P L+SA +Q N Sbjct: 75 KSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRLVSAAVEQLN 117 >At2g38400.1 68415.m04717 alanine--glyoxylate aminotransferase, putative / beta-alanine-pyruvate aminotransferase, putative / AGT, putative similar to SP|Q64565 Alanine--glyoxylate aminotransferase 2, mitochondrial precursor (EC 2.6.1.44) (AGT 2) (Beta-alanine-pyruvate aminotransferase) {Rattus norvegicus}; contains Pfam profile PF00202: aminotransferase, class III Length = 477 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 385 YFFDADGNAFLDAFTQISSLPVGYNHPELLSAFEDQ 492 Y FD G +LDAF I+ + G+ HP+++ +Q Sbjct: 90 YLFDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQ 125 >At5g27610.1 68418.m03308 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 969 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 548 LAREIEKCVIICWTRWVGQHSANDVWLLF 634 L R+I+KC+ IC + +H ++D +LF Sbjct: 705 LRRQIDKCLAICKEARLNRHPSSDASVLF 733 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,138,480 Number of Sequences: 28952 Number of extensions: 249841 Number of successful extensions: 578 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -