BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20334 (499 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000F2E961 Cluster: PREDICTED: similar to alpha-NAC,... 62 9e-09 UniRef50_Q13765 Cluster: Nascent polypeptide-associated complex ... 62 9e-09 UniRef50_UPI0000E2148E Cluster: PREDICTED: similar to KIAA0363; ... 58 8e-08 UniRef50_Q5SWP3 Cluster: NAC-alpha domain-containing protein 1; ... 58 8e-08 UniRef50_O15069 Cluster: NAC-alpha domain-containing protein 1; ... 58 8e-08 UniRef50_UPI0000D9A813 Cluster: PREDICTED: similar to nascent po... 57 2e-07 UniRef50_O97212 Cluster: Possible nascent polypeptide associated... 57 2e-07 UniRef50_UPI00005A170F Cluster: PREDICTED: similar to nascent po... 56 3e-07 UniRef50_UPI0000E7FCB7 Cluster: PREDICTED: similar to mKIAA0363 ... 55 8e-07 UniRef50_P87147 Cluster: Nascent polypeptide-associated complex ... 54 1e-06 UniRef50_Q94518 Cluster: Nascent polypeptide-associated complex ... 54 1e-06 UniRef50_A2DAU3 Cluster: NAC domain containing protein; n=3; Tri... 47 2e-04 UniRef50_Q94JX9 Cluster: Nascent polypeptide-associated complex ... 47 2e-04 UniRef50_P0C2C7 Cluster: Nascent polypeptide-associated complex ... 47 3e-04 UniRef50_Q8LGC6 Cluster: Nascent polypeptide-associated complex ... 47 3e-04 UniRef50_Q756T5 Cluster: Nascent polypeptide-associated complex ... 46 4e-04 UniRef50_A6SB28 Cluster: Nascent polypeptide-associated complex ... 46 6e-04 UniRef50_Q6CDH0 Cluster: Nascent polypeptide-associated complex ... 45 8e-04 UniRef50_Q9LHG9 Cluster: Nascent polypeptide-associated complex ... 42 0.008 UniRef50_Q5CRB7 Cluster: Nascent polypeptide associated complex ... 40 0.031 UniRef50_A7KN23 Cluster: Nascent polypeptide-associated complex ... 39 0.054 UniRef50_Q9VPV7 Cluster: CG4415-PA; n=3; Sophophora|Rep: CG4415-... 39 0.072 UniRef50_P38879 Cluster: Nascent polypeptide-associated complex ... 38 0.13 UniRef50_Q4P341 Cluster: Nascent polypeptide-associated complex ... 38 0.17 UniRef50_Q5DBN5 Cluster: SJCHGC09320 protein; n=1; Schistosoma j... 35 0.88 UniRef50_Q7RBD3 Cluster: Putative uncharacterized protein PY0621... 35 1.2 UniRef50_Q4N187 Cluster: Nascent polypeptide associated complex ... 34 1.5 UniRef50_UPI0000499C9B Cluster: alpha-NAC protein; n=2; Entamoeb... 33 4.7 >UniRef50_UPI0000F2E961 Cluster: PREDICTED: similar to alpha-NAC, muscle-specific form gp220; n=1; Monodelphis domestica|Rep: PREDICTED: similar to alpha-NAC, muscle-specific form gp220 - Monodelphis domestica Length = 1027 Score = 61.7 bits (143), Expect = 9e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VMSQANVSRAKAVRALKNN +DIVNAIMELTM Sbjct: 995 LVMSQANVSRAKAVRALKNNSNDIVNAIMELTM 1027 >UniRef50_Q13765 Cluster: Nascent polypeptide-associated complex subunit alpha; n=41; Eukaryota|Rep: Nascent polypeptide-associated complex subunit alpha - Homo sapiens (Human) Length = 215 Score = 61.7 bits (143), Expect = 9e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VMSQANVSRAKAVRALKNN +DIVNAIMELTM Sbjct: 183 LVMSQANVSRAKAVRALKNNSNDIVNAIMELTM 215 >UniRef50_UPI0000E2148E Cluster: PREDICTED: similar to KIAA0363; n=1; Pan troglodytes|Rep: PREDICTED: similar to KIAA0363 - Pan troglodytes Length = 1226 Score = 58.4 bits (135), Expect = 8e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VM+QANVSRAKAVRAL++N SDIVNAIMELTM Sbjct: 1194 LVMAQANVSRAKAVRALRDNHSDIVNAIMELTM 1226 >UniRef50_Q5SWP3 Cluster: NAC-alpha domain-containing protein 1; n=3; Murinae|Rep: NAC-alpha domain-containing protein 1 - Mus musculus (Mouse) Length = 1504 Score = 58.4 bits (135), Expect = 8e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VM+QANV+RAKAVRALK+N SDIVNAIMELTM Sbjct: 1472 LVMAQANVTRAKAVRALKDNHSDIVNAIMELTM 1504 >UniRef50_O15069 Cluster: NAC-alpha domain-containing protein 1; n=4; Homo sapiens|Rep: NAC-alpha domain-containing protein 1 - Homo sapiens (Human) Length = 1562 Score = 58.4 bits (135), Expect = 8e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VM+QANVSRAKAVRAL++N SDIVNAIMELTM Sbjct: 1530 LVMAQANVSRAKAVRALRDNHSDIVNAIMELTM 1562 >UniRef50_UPI0000D9A813 Cluster: PREDICTED: similar to nascent polypeptide-associated complex alpha polypeptide; n=1; Macaca mulatta|Rep: PREDICTED: similar to nascent polypeptide-associated complex alpha polypeptide - Macaca mulatta Length = 408 Score = 57.2 bits (132), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VMSQANV RAKAV+ALKNN +DIVNAIMELTM Sbjct: 376 LVMSQANVWRAKAVQALKNNSNDIVNAIMELTM 408 >UniRef50_O97212 Cluster: Possible nascent polypeptide associated complex subunit, copy 2; n=9; Trypanosomatidae|Rep: Possible nascent polypeptide associated complex subunit, copy 2 - Leishmania major Length = 244 Score = 57.2 bits (132), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VMSQANVSR+KA++ALKNN DIVN IMELTM Sbjct: 212 VVMSQANVSRSKAIKALKNNNGDIVNTIMELTM 244 >UniRef50_UPI00005A170F Cluster: PREDICTED: similar to nascent polypeptide-associated complex alpha polypeptide; n=1; Canis lupus familiaris|Rep: PREDICTED: similar to nascent polypeptide-associated complex alpha polypeptide - Canis familiaris Length = 167 Score = 56.4 bits (130), Expect = 3e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VMSQANVSRAKAVRALKN ++DI++AIMELTM Sbjct: 135 LVMSQANVSRAKAVRALKNKRNDILSAIMELTM 167 >UniRef50_UPI0000E7FCB7 Cluster: PREDICTED: similar to mKIAA0363 protein; n=3; Gallus gallus|Rep: PREDICTED: similar to mKIAA0363 protein - Gallus gallus Length = 1396 Score = 55.2 bits (127), Expect = 8e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VM+QANVSR KAVRAL++N +DIVNAIMELTM Sbjct: 1364 LVMAQANVSRPKAVRALRHNNNDIVNAIMELTM 1396 >UniRef50_P87147 Cluster: Nascent polypeptide-associated complex subunit alpha; n=16; Ascomycota|Rep: Nascent polypeptide-associated complex subunit alpha - Schizosaccharomyces pombe (Fission yeast) Length = 173 Score = 54.4 bits (125), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VM+QANVSRAKAV ALK N SD+VNAIM LTM Sbjct: 141 LVMAQANVSRAKAVTALKENNSDVVNAIMSLTM 173 >UniRef50_Q94518 Cluster: Nascent polypeptide-associated complex subunit alpha; n=32; Eukaryota|Rep: Nascent polypeptide-associated complex subunit alpha - Drosophila melanogaster (Fruit fly) Length = 217 Score = 54.4 bits (125), Expect = 1e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +V++QAN +RAKA++ALKNN +DIVNAIMELTM Sbjct: 184 LVITQANTTRAKAIKALKNNNNDIVNAIMELTM 216 >UniRef50_A2DAU3 Cluster: NAC domain containing protein; n=3; Trichomonas vaginalis G3|Rep: NAC domain containing protein - Trichomonas vaginalis G3 Length = 167 Score = 47.2 bits (107), Expect = 2e-04 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VM QANVSRAKA++AL++N +D+V A+M LT+ Sbjct: 135 MVMQQANVSRAKAIKALRDNNNDMVTAVMNLTV 167 >UniRef50_Q94JX9 Cluster: Nascent polypeptide-associated complex subunit alpha-like protein 2; n=15; Magnoliophyta|Rep: Nascent polypeptide-associated complex subunit alpha-like protein 2 - Arabidopsis thaliana (Mouse-ear cress) Length = 217 Score = 47.2 bits (107), Expect = 2e-04 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELT 164 +VM+QA VSR+KAV+ALK++ DIV+AIMELT Sbjct: 185 LVMTQAGVSRSKAVKALKSHDGDIVSAIMELT 216 >UniRef50_P0C2C7 Cluster: Nascent polypeptide-associated complex subunit alpha; n=17; Ascomycota|Rep: Nascent polypeptide-associated complex subunit alpha - Aspergillus terreus (strain NIH 2624) Length = 202 Score = 46.8 bits (106), Expect = 3e-04 Identities = 21/33 (63%), Positives = 29/33 (87%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VM+QANVSR KAV+AL+ N +DIVN+IM L++ Sbjct: 170 LVMAQANVSRKKAVKALRENDNDIVNSIMALSI 202 >UniRef50_Q8LGC6 Cluster: Nascent polypeptide-associated complex subunit alpha-like protein 5; n=6; Magnoliophyta|Rep: Nascent polypeptide-associated complex subunit alpha-like protein 5 - Arabidopsis thaliana (Mouse-ear cress) Length = 209 Score = 46.8 bits (106), Expect = 3e-04 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELT 164 +VM+QA VS+AKAV ALK N DIV+AIMELT Sbjct: 177 LVMTQAGVSKAKAVSALKANDGDIVSAIMELT 208 >UniRef50_Q756T5 Cluster: Nascent polypeptide-associated complex subunit alpha; n=1; Eremothecium gossypii|Rep: Nascent polypeptide-associated complex subunit alpha - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 168 Score = 46.4 bits (105), Expect = 4e-04 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELT 164 +VM QANVSR KAV+AL+ + SDIVNAIM L+ Sbjct: 136 LVMQQANVSRNKAVKALREHNSDIVNAIMSLS 167 >UniRef50_A6SB28 Cluster: Nascent polypeptide-associated complex alpha polypeptide; n=2; Sclerotiniaceae|Rep: Nascent polypeptide-associated complex alpha polypeptide - Botryotinia fuckeliana B05.10 Length = 212 Score = 45.6 bits (103), Expect = 6e-04 Identities = 21/33 (63%), Positives = 29/33 (87%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +VM+QA+VSR KAV+ALK N +DIVN+IM L++ Sbjct: 180 LVMTQASVSRNKAVKALKENDNDIVNSIMALSI 212 >UniRef50_Q6CDH0 Cluster: Nascent polypeptide-associated complex subunit alpha; n=1; Yarrowia lipolytica|Rep: Nascent polypeptide-associated complex subunit alpha - Yarrowia lipolytica (Candida lipolytica) Length = 198 Score = 45.2 bits (102), Expect = 8e-04 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMEL 161 +VM QANVSR KA+ LK N SD+VN IM+L Sbjct: 166 LVMEQANVSRNKAINGLKKNDSDVVNTIMDL 196 >UniRef50_Q9LHG9 Cluster: Nascent polypeptide-associated complex subunit alpha-like protein 1; n=2; Eukaryota|Rep: Nascent polypeptide-associated complex subunit alpha-like protein 1 - Arabidopsis thaliana (Mouse-ear cress) Length = 203 Score = 41.9 bits (94), Expect = 0.008 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELT 164 +VM+QA VSR AV+ALK DIV+AIMELT Sbjct: 171 LVMTQAGVSRPNAVKALKAADGDIVSAIMELT 202 >UniRef50_Q5CRB7 Cluster: Nascent polypeptide associated complex alpha chain with an NAC domain; n=2; Cryptosporidium|Rep: Nascent polypeptide associated complex alpha chain with an NAC domain - Cryptosporidium parvum Iowa II Length = 196 Score = 39.9 bits (89), Expect = 0.031 Identities = 17/32 (53%), Positives = 26/32 (81%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELT 164 +V++Q SRAKAV+ALK+N +D+V AI+ L+ Sbjct: 164 LVINQTGCSRAKAVKALKSNNNDVVEAILSLS 195 >UniRef50_A7KN23 Cluster: Nascent polypeptide-associated complex subunit alpha; n=8; Melampsora medusae f. sp. deltoidis|Rep: Nascent polypeptide-associated complex subunit alpha - Melampsora medusae f. sp. deltoidis Length = 181 Score = 39.1 bits (87), Expect = 0.054 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = +3 Query: 72 VMSQANVSRAKAVRALKNNQSDIVNAIM 155 VM+Q N SR KAV+ALK N D++NAI+ Sbjct: 151 VMTQVNCSRNKAVKALKENDGDLINAII 178 >UniRef50_Q9VPV7 Cluster: CG4415-PA; n=3; Sophophora|Rep: CG4415-PA - Drosophila melanogaster (Fruit fly) Length = 347 Score = 38.7 bits (86), Expect = 0.072 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELTM 167 +V QA SR KA++AL N +D+VNAIM LT+ Sbjct: 314 LVQMQAACSRKKAIQALLKNDNDVVNAIMALTV 346 >UniRef50_P38879 Cluster: Nascent polypeptide-associated complex subunit alpha; n=11; Saccharomycetales|Rep: Nascent polypeptide-associated complex subunit alpha - Saccharomyces cerevisiae (Baker's yeast) Length = 174 Score = 37.9 bits (84), Expect = 0.13 Identities = 16/32 (50%), Positives = 25/32 (78%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELT 164 +V+ Q NVS+ +A++ALK + D+VNAIM L+ Sbjct: 142 LVVQQTNVSKNQAIKALKAHNGDLVNAIMSLS 173 >UniRef50_Q4P341 Cluster: Nascent polypeptide-associated complex subunit alpha; n=1; Ustilago maydis|Rep: Nascent polypeptide-associated complex subunit alpha - Ustilago maydis (Smut fungus) Length = 190 Score = 37.5 bits (83), Expect = 0.17 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIM 155 +VM Q + SR KAV+ALK + D++NAIM Sbjct: 159 LVMQQVSCSRRKAVKALKESNGDLINAIM 187 >UniRef50_Q5DBN5 Cluster: SJCHGC09320 protein; n=1; Schistosoma japonicum|Rep: SJCHGC09320 protein - Schistosoma japonicum (Blood fluke) Length = 226 Score = 35.1 bits (77), Expect = 0.88 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIV 143 ++M QA VSR+KA+RAL+ N D+V Sbjct: 180 LIMQQAGVSRSKAIRALRENNDDMV 204 >UniRef50_Q7RBD3 Cluster: Putative uncharacterized protein PY06211; n=1; Plasmodium yoelii yoelii|Rep: Putative uncharacterized protein PY06211 - Plasmodium yoelii yoelii Length = 52 Score = 34.7 bits (76), Expect = 1.2 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELT 164 +++SQ ++ KA+ LK N +D+V +IMEL+ Sbjct: 20 LIISQTKCTKEKAIEVLKKNNNDLVQSIMELS 51 >UniRef50_Q4N187 Cluster: Nascent polypeptide associated complex alpha subunit, putative; n=2; Theileria|Rep: Nascent polypeptide associated complex alpha subunit, putative - Theileria parva Length = 200 Score = 34.3 bits (75), Expect = 1.5 Identities = 16/32 (50%), Positives = 24/32 (75%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIMELT 164 +V+ QA SR KAV++L ++ +IV +IMELT Sbjct: 167 LVVQQAGCSREKAVQSLVKHRGNIVESIMELT 198 >UniRef50_UPI0000499C9B Cluster: alpha-NAC protein; n=2; Entamoeba histolytica HM-1:IMSS|Rep: alpha-NAC protein - Entamoeba histolytica HM-1:IMSS Length = 437 Score = 32.7 bits (71), Expect = 4.7 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +3 Query: 69 IVMSQANVSRAKAVRALKNNQSDIVNAIME 158 ++MSQAN + KA ALK + D+V+A E Sbjct: 406 VLMSQANTTHEKAYAALKKTKGDLVSAFFE 435 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 341,968,668 Number of Sequences: 1657284 Number of extensions: 5151674 Number of successful extensions: 10540 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 10390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10537 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29273652170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -