BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20329 (410 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42849| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.092 SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) 33 0.092 SB_32701| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_42045| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.49 SB_32459| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.65 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.85 SB_10819| Best HMM Match : DCX (HMM E-Value=6.3e-19) 29 1.1 SB_27645| Best HMM Match : VWD (HMM E-Value=0.016) 29 2.0 SB_21145| Best HMM Match : MucBP (HMM E-Value=7.4) 28 2.6 SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_49215| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_42827| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_56420| Best HMM Match : CUB (HMM E-Value=0.45) 27 4.5 SB_8534| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_54310| Best HMM Match : Aa_trans (HMM E-Value=1.9e-23) 27 6.0 SB_29067| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_19083| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_17583| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_14921| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_3942| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_36986| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_2355| Best HMM Match : Carn_acyltransf (HMM E-Value=0) 27 7.9 SB_58849| Best HMM Match : zf-piccolo (HMM E-Value=2.8) 27 7.9 SB_57839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_37768| Best HMM Match : SpoVG (HMM E-Value=7.9) 27 7.9 SB_37548| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_28927| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_10359| Best HMM Match : CoA_transf_3 (HMM E-Value=0) 27 7.9 >SB_42849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 33.1 bits (72), Expect = 0.092 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +3 Query: 162 VNFRGLLGDGNNEPYDDFRLPNGKICTSESESV 260 + F GLLG NNE +D+ PNGK S E V Sbjct: 59 IPFTGLLGTNNNEHHDEMTKPNGKHAGSLIEFV 91 >SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) Length = 2200 Score = 33.1 bits (72), Expect = 0.092 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +3 Query: 162 VNFRGLLGDGNNEPYDDFRLPNGKICTSESESV 260 + F GLLG NNE +D+ PNGK S E V Sbjct: 1807 IPFTGLLGTNNNEHHDEMTKPNGKHAGSLIEFV 1839 >SB_32701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 31.5 bits (68), Expect = 0.28 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 171 RGLLGDGNNEPYDDFRLPNGKICTSESE 254 RGL GD N E YD+F+ P G+ + + Sbjct: 26 RGLCGDMNGEQYDEFQSPTGEFLNNADQ 53 >SB_42045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 31.5 bits (68), Expect = 0.28 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +3 Query: 165 NFRGLLGDGNNEPYDDFRLPNGKICTSESESVTRTVWPAAVHRCKP 302 N GL G+ N P DDF + NG+ S+ E W HR +P Sbjct: 179 NTCGLCGNFNGVPSDDFMMKNGRYARSDRE--FGKSWSLGGHRRRP 222 >SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 31.5 bits (68), Expect = 0.28 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 171 RGLLGDGNNEPYDDFRLPNGKICTSESE 254 RGL GD N E YD+F+ P G+ + + Sbjct: 1436 RGLCGDMNGEQYDEFQSPTGEFLNNADQ 1463 >SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1417 Score = 30.7 bits (66), Expect = 0.49 Identities = 20/69 (28%), Positives = 27/69 (39%) Frame = +1 Query: 166 TSAVFSETVTTSLTMTSGYLMERSALRKASR*RVPSGPQLSTGASRPNTPITSCTMHPSP 345 TS ET T+S TS S S + + P T S P T + SP Sbjct: 668 TSTSPQETSTSSSKQTSTQQTSSSQQTSTSPPQTTTSPSQQTSTSPPQTTTSPSQQTTSP 727 Query: 346 PPANRXSGE 372 PP++ G+ Sbjct: 728 PPSSPSIGQ 736 >SB_32459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2011 Score = 30.3 bits (65), Expect = 0.65 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +1 Query: 283 LSTGASRPNT--PITSCTMHPSPPPANRXSGEYRRSGP 390 L+ G RP T P T TM P+P P + G +GP Sbjct: 102 LTRGTERPRTTFPETGITMRPTPGPVSGFPGSLPTTGP 139 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 29.9 bits (64), Expect = 0.85 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 268 PSGPQLSTGASRPNTPITSCTMHPSPPPANRXS 366 PS P + S P TP T CT P+ P NR S Sbjct: 862 PSTPSTPSTPSTPKTPSTPCT--PNTPSTNRKS 892 Score = 28.7 bits (61), Expect = 2.0 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 268 PSGPQLSTGASRPNTPITSCTMHPSPPPANR 360 PS P + S P TP T CT P+ P NR Sbjct: 312 PSTPSTPSTPSTPKTPSTPCT--PNTPSTNR 340 Score = 26.6 bits (56), Expect = 7.9 Identities = 22/64 (34%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +1 Query: 166 TSAVFSETVTTSLTMTSGYLMERSALRKASR*RVPSGPQLSTGASRPNTPITSCT-MHPS 342 T + S T SLT T S S +P+ P + S P+TPIT T PS Sbjct: 663 TPSTPSTPSTPSLTHTPSTPSTPSTPSTPSTPSMPNTPSTPSTPSTPSTPITPGTPSTPS 722 Query: 343 PPPA 354 P A Sbjct: 723 TPSA 726 >SB_10819| Best HMM Match : DCX (HMM E-Value=6.3e-19) Length = 1199 Score = 29.5 bits (63), Expect = 1.1 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 222 PNGKICTSESESVTRTVWPAAVHRCKPPEHSHHQLYD 332 PNG ICT +S S T TVW + K + H+L D Sbjct: 534 PNGDICTGDS-SGTVTVWGKVSKKIKFVVRNAHELTD 569 >SB_27645| Best HMM Match : VWD (HMM E-Value=0.016) Length = 237 Score = 28.7 bits (61), Expect = 2.0 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 147 TASTWVNFRGLLGDGNNEPYDDFRLPNGK 233 TA+ + N GL GD +N P +DF P G+ Sbjct: 194 TAAFYGNTGGLCGDMDNNPANDFTGPTGE 222 >SB_21145| Best HMM Match : MucBP (HMM E-Value=7.4) Length = 203 Score = 28.3 bits (60), Expect = 2.6 Identities = 18/66 (27%), Positives = 28/66 (42%) Frame = +3 Query: 162 VNFRGLLGDGNNEPYDDFRLPNGKICTSESESVTRTVWPAAVHRCKPPEHSHHQLYDASL 341 VNF + D N Y F PN + TS + + T H+ S + +D + Sbjct: 73 VNFLDVTFDLNRNTYQPFTKPNAPLHTSTARATTH-------HKRLSTLSSDKETFDQAA 125 Query: 342 PPACEQ 359 PPA ++ Sbjct: 126 PPALDE 131 >SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2537 Score = 27.9 bits (59), Expect = 3.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 183 GDGNNEPYDDFRLPNGKICTSESESVTRTVWPA 281 G ++EP DD R N I +SES +++ PA Sbjct: 1710 GSAHDEPPDDSRSDNDSIMSSESGTISDMCLPA 1742 >SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2142 Score = 27.9 bits (59), Expect = 3.4 Identities = 23/60 (38%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +1 Query: 178 FSETVTTSLTMTSGYLMERSALRKASR*RVPSG-PQLSTGASRPNTPITSCTMHPSPPPA 354 F+ETVT S + L AL +A PS P+ S SR P S M PPPA Sbjct: 1381 FTETVTCSSYEVTNPLNTHPALVRADSSEEPSNAPKHSPLGSRHQPP-PSVDMSQPPPPA 1439 >SB_49215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 27.5 bits (58), Expect = 4.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 36 KRMCSLSVNQATESVLAHWTASWPSA 113 K CSL + +L HW +WPS+ Sbjct: 349 KSFCSLYPRELEMRLLGHWHFTWPSS 374 >SB_42827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 27.5 bits (58), Expect = 4.5 Identities = 11/43 (25%), Positives = 24/43 (55%) Frame = +3 Query: 39 RMCSLSVNQATESVLAHWTASWPSAHLNLRCATLKLTASTWVN 167 RMC+ ++ + ++ A WPS+++ + T + A+T +N Sbjct: 23 RMCANNICENIARIVVDAQAKWPSSNITISGITYRRDANTKLN 65 >SB_56420| Best HMM Match : CUB (HMM E-Value=0.45) Length = 1017 Score = 27.5 bits (58), Expect = 4.5 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 105 PSAHLNLRCATLKLTASTWVNFRGLLGDGNNEPYDDF 215 PS H N KLTA+T N L DG Y+ F Sbjct: 964 PSIHFNHDSPNRKLTANTCANQLTLTVDGRIRQYEHF 1000 >SB_8534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 926 Score = 27.5 bits (58), Expect = 4.5 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +1 Query: 265 VPSGPQLSTGASRPNTPITSCTMHP---SPPPAN 357 VP P S+ ASRPN +S + P + PP+N Sbjct: 731 VPVQPSTSSAASRPNLSASSAPLEPLSITIPPSN 764 >SB_54310| Best HMM Match : Aa_trans (HMM E-Value=1.9e-23) Length = 977 Score = 27.1 bits (57), Expect = 6.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 288 HRCKPPEHSHHQLYDASLPP 347 ++C PP S H+LY +PP Sbjct: 957 YQCLPPPLSLHELYSRGIPP 976 >SB_29067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 295 ASRPNTPITSCTMHPSPPPANRXSGEYRRSGP 390 +S+P++P + PS P+NR S Y +SGP Sbjct: 83 SSKPSSP--AINKAPSTAPSNRPSQIYGKSGP 112 >SB_19083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 27.1 bits (57), Expect = 6.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 330 RTAGDGSVRAACTCGQLR 277 R AGDG +R AC G+LR Sbjct: 283 RIAGDGELRIACCDGELR 300 Score = 27.1 bits (57), Expect = 6.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 330 RTAGDGSVRAACTCGQLR 277 R AGDG +R AC G+LR Sbjct: 300 RIAGDGELRIACCDGELR 317 >SB_17583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.1 bits (57), Expect = 6.0 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 5/67 (7%) Frame = +3 Query: 162 VNFRGLLGDGNNEPYDDFRLPNGKICTSESES-----VTRTVWPAAVHRCKPPEHSHHQL 326 VNF + D N Y F PN + ES +T+ + PA++++ S + Sbjct: 27 VNFLNVTFDLNRNTYQPFTKPNAPLQYVHRESNHPPTITKNI-PASINKRLSTLSSDKET 85 Query: 327 YDASLPP 347 +D + PP Sbjct: 86 FDQAAPP 92 >SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 756 Score = 27.1 bits (57), Expect = 6.0 Identities = 21/88 (23%), Positives = 36/88 (40%), Gaps = 6/88 (6%) Frame = +3 Query: 102 WPSAHLNLRCATLKLTASTWV-NFRGLLGDGNNEPYDDFRLPNGKICTSESES-----VT 263 W + +C A+ V NF + D N Y F PN + ES +T Sbjct: 128 WGDSKKTRKCGIAPCPANKRVVNFLDVTFDLNRNTYQPFTKPNAPLQYVHRESNHPPTIT 187 Query: 264 RTVWPAAVHRCKPPEHSHHQLYDASLPP 347 + + PA++++ S + +D + PP Sbjct: 188 KNI-PASINKRLSTLSSDKETFDQAAPP 214 >SB_14921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 27.1 bits (57), Expect = 6.0 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%) Frame = -1 Query: 356 FAGGGEGCIVQLVM-----GVFGRLAPVDSCGPDGTRY--RLAFRSADLSI 225 FAGGG C++ +++ G GR +D+ DG Y A+ S DL I Sbjct: 16 FAGGGLMCVMGILLALLERGKSGRGQVIDTAMVDGAAYVGSFAYMSQDLGI 66 >SB_3942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 27.1 bits (57), Expect = 6.0 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 105 PSAHLNLRCATLKLTASTWVNFRGLLGDGNNEPYDDF 215 PS H N KLTA+T N L DG Y+ F Sbjct: 272 PSIHFNQDNPNRKLTANTCANQLTLTVDGRIRKYEHF 308 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 26.6 bits (56), Expect = 7.9 Identities = 28/113 (24%), Positives = 41/113 (36%) Frame = +3 Query: 12 LPKDSRSSKRMCSLSVNQATESVLAHWTASWPSAHLNLRCATLKLTASTWVNFRGLLGDG 191 LP S S C + ESV++H AS SA T +L ++ + + Sbjct: 2459 LPSGSNFSSSRCDVPQLVTDESVISHEKASTSSATNFKESQTSRLHSTGTADVAECIQSA 2518 Query: 192 NNEPYDDFRLPNGKICTSESESVTRTVWPAAVHRCKPPEHSHHQLYDASLPPA 350 + P K S SES T WP R + + + +PPA Sbjct: 2519 S--PLSSTH--ERKTPESFSESSTNGEWPWGRRRSPASSNDSYGKLPSDVPPA 2567 >SB_36986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 26.6 bits (56), Expect = 7.9 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 5/67 (7%) Frame = +3 Query: 162 VNFRGLLGDGNNEPYDDFRLPNGKICTSESES-----VTRTVWPAAVHRCKPPEHSHHQL 326 VNF + D N Y F PN + ES +T+ + PA++++ S + Sbjct: 309 VNFLDVTFDLNRNTYQPFTKPNAPLQYVHRESNHPSTITKNI-PASINKRLSTLSSDKET 367 Query: 327 YDASLPP 347 +D + PP Sbjct: 368 FDQAAPP 374 >SB_2355| Best HMM Match : Carn_acyltransf (HMM E-Value=0) Length = 1559 Score = 26.6 bits (56), Expect = 7.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 331 MHPSPPPANRXSGEYRRS 384 +HP PPP R +G RRS Sbjct: 405 LHPYPPPWQRQAGNTRRS 422 >SB_58849| Best HMM Match : zf-piccolo (HMM E-Value=2.8) Length = 243 Score = 26.6 bits (56), Expect = 7.9 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 5/67 (7%) Frame = +3 Query: 162 VNFRGLLGDGNNEPYDDFRLPNGKICTSESES-----VTRTVWPAAVHRCKPPEHSHHQL 326 VNF + D N Y F PN + ES +T+ + PA++++ S + Sbjct: 144 VNFLDVTFDLNRNTYQPFTKPNAPLQYVHRESNHPPTITKNI-PASINKRLSTLSSDKET 202 Query: 327 YDASLPP 347 +D + PP Sbjct: 203 FDQAAPP 209 >SB_57839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 26.6 bits (56), Expect = 7.9 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 5/67 (7%) Frame = +3 Query: 162 VNFRGLLGDGNNEPYDDFRLPNGKICTSESES-----VTRTVWPAAVHRCKPPEHSHHQL 326 VNF + D N Y F PN + ES +T+ + PA++++ S + Sbjct: 20 VNFLDVTFDLNRNTYQPFTKPNAPLQYVHRESNHPPTITKNI-PASINKRLSTLSSDKET 78 Query: 327 YDASLPP 347 +D + PP Sbjct: 79 FDQAAPP 85 >SB_37768| Best HMM Match : SpoVG (HMM E-Value=7.9) Length = 163 Score = 26.6 bits (56), Expect = 7.9 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 5/67 (7%) Frame = +3 Query: 162 VNFRGLLGDGNNEPYDDFRLPNGKICTSESES-----VTRTVWPAAVHRCKPPEHSHHQL 326 VNF + D N Y F PN + ES +T+ + PA++++ S + Sbjct: 73 VNFLDVTFDLNRNTYQPFTKPNAPLQYVHRESNHPPTITKNI-PASINKRLSTLSSDKET 131 Query: 327 YDASLPP 347 +D + PP Sbjct: 132 FDQAAPP 138 >SB_37548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 26.6 bits (56), Expect = 7.9 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 5/67 (7%) Frame = +3 Query: 162 VNFRGLLGDGNNEPYDDFRLPNGKICTSESES-----VTRTVWPAAVHRCKPPEHSHHQL 326 VNF + D N Y F PN + ES +T+ + PA++++ S + Sbjct: 73 VNFLDVTFDLNRNTYQPFTKPNAPLQYVHRESNHPPTITKNI-PASINKRLSTLSSDKET 131 Query: 327 YDASLPP 347 +D + PP Sbjct: 132 FDQAAPP 138 >SB_28927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 7.9 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 5/67 (7%) Frame = +3 Query: 162 VNFRGLLGDGNNEPYDDFRLPNGKICTSESES-----VTRTVWPAAVHRCKPPEHSHHQL 326 VNF + D N Y F PN + ES +T+ + PA++++ S + Sbjct: 73 VNFLDVTFDLNRNTYQPFTKPNAPLQYVHRESNHQPTITKNI-PASINKRLSTLSSDKET 131 Query: 327 YDASLPP 347 +D + PP Sbjct: 132 FDRAAPP 138 >SB_10359| Best HMM Match : CoA_transf_3 (HMM E-Value=0) Length = 382 Score = 26.6 bits (56), Expect = 7.9 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%) Frame = -1 Query: 356 FAGGGEGCIVQLVM-----GVFGRLAPVDSCGPDGTRY--RLAFRSADLSI 225 FAGGG C++ +++ G GR +D+ DG Y A+ S DL I Sbjct: 155 FAGGGLMCVMGILLALLERGKSGRGQVIDTAMVDGAPYVGSFAYMSQDLGI 205 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,514,362 Number of Sequences: 59808 Number of extensions: 312001 Number of successful extensions: 1396 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 1212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1381 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 752487277 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -