BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20328 (458 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC088372-1|AAH88372.1| 365|Homo sapiens APBB2 protein protein. 30 3.3 BC027946-1|AAH27946.2| 736|Homo sapiens amyloid beta (A4) precu... 30 3.3 >BC088372-1|AAH88372.1| 365|Homo sapiens APBB2 protein protein. Length = 365 Score = 30.3 bits (65), Expect = 3.3 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 372 NDL-DIVSGHDESKV*WKVLSNNFLSVADPQLVAVLHGVPFLSM 244 ND+ D V E K + +L N+ LS+ DP +VLH P +S+ Sbjct: 62 NDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVLHSQPIVSI 105 >BC027946-1|AAH27946.2| 736|Homo sapiens amyloid beta (A4) precursor protein-binding, family B, member 2 (Fe65-like) protein. Length = 736 Score = 30.3 bits (65), Expect = 3.3 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 372 NDL-DIVSGHDESKV*WKVLSNNFLSVADPQLVAVLHGVPFLSM 244 ND+ D V E K + +L N+ LS+ DP +VLH P +S+ Sbjct: 434 NDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVLHSQPIVSI 477 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,805,319 Number of Sequences: 237096 Number of extensions: 1206085 Number of successful extensions: 2016 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2009 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3872123864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -