BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20323 (445 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 6.1 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 6.1 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.0 bits (42), Expect = 6.1 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +2 Query: 119 SPYVRESMLDTHSLWSNLANEMQHLDNMMKELS 217 SP +S + HSL+ + H D+ + S Sbjct: 84 SPTQLQSFMQQHSLYLQQQQQQHHQDSSSEHAS 116 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 6.1 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -2 Query: 72 YCGAAETAASSPHNTKAIILVER 4 YCG + SP++T A+ + R Sbjct: 86 YCGIGKECELSPNSTIAVCVCMR 108 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,412 Number of Sequences: 438 Number of extensions: 2649 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -