BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20321 (515 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g46180.1 68418.m05680 ornithine aminotransferase, putative / ... 124 3e-29 At1g80600.1 68414.m09457 acetylornithine aminotransferase, mitoc... 45 3e-05 At4g39660.1 68417.m05608 alanine--glyoxylate aminotransferase, p... 43 1e-04 At2g38400.1 68415.m04717 alanine--glyoxylate aminotransferase, p... 41 4e-04 At3g08860.1 68416.m01030 alanine--glyoxylate aminotransferase, p... 40 8e-04 At5g63570.1 68418.m07979 glutamate-1-semialdehyde 2,1-aminomutas... 31 0.61 At2g17620.1 68415.m02038 cyclin, putative (CYC2a) similar to cyc... 29 2.5 At1g72730.1 68414.m08410 eukaryotic translation initiation facto... 29 2.5 At1g09710.1 68414.m01090 myb family transcription factor contain... 29 2.5 At1g54270.1 68414.m06187 eukaryotic translation initiation facto... 28 3.2 At3g03990.1 68416.m00420 esterase/lipase/thioesterase family pro... 27 5.7 At2g26490.1 68415.m03178 transducin family protein / WD-40 repea... 27 5.7 At5g43310.1 68418.m05293 COP1-interacting protein-related contai... 27 7.5 At3g59290.1 68416.m06609 epsin N-terminal homology (ENTH) domain... 27 7.5 At3g22200.1 68416.m02801 4-aminobutyrate aminotransferase / gamm... 27 9.9 >At5g46180.1 68418.m05680 ornithine aminotransferase, putative / ornithine--oxo-acid aminotransferase, putative similar to SP|Q92413 Ornithine aminotransferase (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase) [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile PF00202: aminotransferase, class III Length = 475 Score = 124 bits (300), Expect = 3e-29 Identities = 54/90 (60%), Positives = 71/90 (78%) Frame = +3 Query: 246 SVRWDVEGKKYYDFLSAYSAVNQGHCHPRIIEALKKQADNLTLVSRAFYSDQLGKYEKYM 425 S WD EGK+Y DFL+AYSAVNQGHCHP+I++AL++Q + LTL SRAFY+D+ + + + Sbjct: 68 STIWDPEGKRYIDFLAAYSAVNQGHCHPKIMKALQEQVEKLTLSSRAFYNDKFPVFAERL 127 Query: 426 TELFGYDRLLPMNTGVEGGESACKIARNGG 515 T +FGYD +LPMNTG EG E+A K+AR G Sbjct: 128 TNMFGYDMVLPMNTGAEGVETALKLARKWG 157 Score = 30.7 bits (66), Expect = 0.61 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 160 SSKEIFQLEDKYGCRNYAPLPVALCRGEG 246 SS+ + +LE ++ NY P+PV R G Sbjct: 39 SSQRLMELESEFSAHNYHPVPVVFSRANG 67 >At1g80600.1 68414.m09457 acetylornithine aminotransferase, mitochondrial, putative / acetylornithine transaminase, putative / AOTA, putative / ACOAT, putative similar to SP|O04866 Acetylornithine aminotransferase, mitochondrial precursor (EC 2.6.1.11) (ACOAT) (Acetylornithine transaminase) (AOTA) {Alnus glutinosa}; contains Pfam profile PF00202: aminotransferase, class III Length = 457 Score = 45.2 bits (102), Expect = 3e-05 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 1/85 (1%) Frame = +3 Query: 255 WDVEGKKYYDFLSAYSAVNQGHCHPRIIEALKKQADNLTLVSRAFYS-DQLGKYEKYMTE 431 +D EGK+Y D S + GH P + A+ +QA L VS +Y+ Q+ ++ + Sbjct: 89 FDPEGKEYLDCASGIAVNALGHGDPDWLRAVTEQAGVLAHVSNVYYTIPQIELAKRLVAS 148 Query: 432 LFGYDRLLPMNTGVEGGESACKIAR 506 F DR+ N+G E E+A K +R Sbjct: 149 SFA-DRVFFCNSGTEANEAAIKFSR 172 >At4g39660.1 68417.m05608 alanine--glyoxylate aminotransferase, putative / beta-alanine-pyruvate aminotransferase, putative / AGT, putative similar to SP|Q64565 Alanine--glyoxylate aminotransferase 2, mitochondrial precursor (EC 2.6.1.44) (AGT 2) (Beta-alanine-pyruvate aminotransferase) {Rattus norvegicus}; contains Pfam profile PF00202: aminotransferase, class III Length = 476 Score = 42.7 bits (96), Expect = 1e-04 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 2/86 (2%) Frame = +3 Query: 255 WDVEGKKYYDFLSAYSAVNQGHCHPRIIEALKKQADNLTLVSRAFYSDQLGKY-EKYMTE 431 +D G++Y D + V+ GHCHP I+ A+ +Q+ L + + +G + E + Sbjct: 90 YDESGRRYLDAFAGIVTVSCGHCHPDILNAITEQSKLLQHATTIYLHHAIGDFAEALAAK 149 Query: 432 LFGYDRLLP-MNTGVEGGESACKIAR 506 + G +++ +N+G E E A +AR Sbjct: 150 MPGNLKVVYFVNSGSEANELAMMMAR 175 >At2g38400.1 68415.m04717 alanine--glyoxylate aminotransferase, putative / beta-alanine-pyruvate aminotransferase, putative / AGT, putative similar to SP|Q64565 Alanine--glyoxylate aminotransferase 2, mitochondrial precursor (EC 2.6.1.44) (AGT 2) (Beta-alanine-pyruvate aminotransferase) {Rattus norvegicus}; contains Pfam profile PF00202: aminotransferase, class III Length = 477 Score = 41.1 bits (92), Expect = 4e-04 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 2/86 (2%) Frame = +3 Query: 255 WDVEGKKYYDFLSAYSAVNQGHCHPRIIEALKKQADNLTLVSRAFYSDQLGKYEKYMTEL 434 +D G++Y D + + VN GHCHP ++E + Q L + + + + + + + Sbjct: 92 FDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQIKRLQHPTVLYLNHAIADFSEALASK 151 Query: 435 FGYDRLLPM--NTGVEGGESACKIAR 506 D + N+G E E A +A+ Sbjct: 152 LPGDLKVVFFTNSGTEANELALMMAK 177 >At3g08860.1 68416.m01030 alanine--glyoxylate aminotransferase, putative / beta-alanine-pyruvate aminotransferase, putative / AGT, putative similar to similar to SP|Q64565 Alanine--glyoxylate aminotransferase 2, mitochondrial precursor (EC 2.6.1.44) (AGT 2) (Beta-alanine-pyruvate aminotransferase) {Rattus norvegicus}; contains Pfam profile PF00202: aminotransferase, class III Length = 481 Score = 40.3 bits (90), Expect = 8e-04 Identities = 20/86 (23%), Positives = 40/86 (46%), Gaps = 2/86 (2%) Frame = +3 Query: 255 WDVEGKKYYDFLSAYSAVNQGHCHPRIIEALKKQADNLTLVSRAFYSDQLGKYEKYMTEL 434 +D G++Y D + V+ GHCHP ++ ++ KQ + + + + + + + + Sbjct: 95 FDENGRRYLDAFGGIATVSCGHCHPEVVNSVVKQLKLINHSTILYLNHTISDFAEALVST 154 Query: 435 FGYDRLLPM--NTGVEGGESACKIAR 506 D + N+G E E A +AR Sbjct: 155 LPGDLKVVFFTNSGTEANELAMMMAR 180 >At5g63570.1 68418.m07979 glutamate-1-semialdehyde 2,1-aminomutase 1 (GSA 1) / glutamate-1-semialdehyde aminotransferase 1 (GSA-AT 1) identical to GSA 1 [SP|P42799] Length = 474 Score = 30.7 bits (66), Expect = 0.61 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +3 Query: 246 SVRWDVEGKKYYDFLSAYSAVNQGHCHPRIIEAL 347 S WD++G +Y D++ ++ GH ++ AL Sbjct: 91 SKMWDIDGNEYIDYVGSWGPAIIGHADDEVLAAL 124 >At2g17620.1 68415.m02038 cyclin, putative (CYC2a) similar to cyclin 2b protein [Arabidopsis thaliana] GI:509423; contains Pfam profiles PF00134: Cyclin, N-terminal domain, PF02984: Cyclin, C-terminal domain; identical to cDNA cyc2a mRNA for cyclin 2a protein GI:728518 Length = 429 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 318 HCHPRIIEALKKQADNLTLVSRAFYSDQLGKYEKYMTELFGY 443 HCH + ++ ++L RA + G Y KY T FGY Sbjct: 371 HCHYSEDQLMECSRKLVSLHQRAATGNLTGVYRKYSTSKFGY 412 >At1g72730.1 68414.m08410 eukaryotic translation initiation factor 4A, putative / eIF-4A, putative similar to Eukaryotic initiation factor 4A-10 GB:P41382 [Nicotiana tabacum]; identical to (putative) RNA helicase GB:CAA09211 [Arabidopsis thaliana] (Nucleic Acids Res. 27 (2), 628-636 (1999)) Length = 414 Score = 28.7 bits (61), Expect = 2.5 Identities = 20/75 (26%), Positives = 42/75 (56%), Gaps = 2/75 (2%) Frame = -1 Query: 332 SRVAVT--LVNCGVCA*KIIILFSFDIPTNTPSPRHKATGKGA*FLQPYLSSNWKISLDD 159 SRV +T L+ G+ ++ ++ +FD+PT + H+ G+ F + ++ N+ S D+ Sbjct: 331 SRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHR-IGRSGRFGRKGVAINFMTSEDE 389 Query: 158 KFCSAIILRNFYDMV 114 + + I + FY++V Sbjct: 390 RMMADI--QRFYNVV 402 >At1g09710.1 68414.m01090 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 689 Score = 28.7 bits (61), Expect = 2.5 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 8/36 (22%) Frame = -2 Query: 502 AILHALS------PPSTPVFIG--SRRSYPNNSVIY 419 A+ HALS PPS + IG SRRS+P NS IY Sbjct: 309 AVNHALSLALGNRPPSNKLAIGTSSRRSFPANSSIY 344 >At1g54270.1 68414.m06187 eukaryotic translation initiation factor 4A-2 / eIF-4A-2 similar to eukaryotic translation initiation factor 4A GI:19696 from [Nicotiana plumbaginifolia] Length = 412 Score = 28.3 bits (60), Expect = 3.2 Identities = 26/90 (28%), Positives = 49/90 (54%), Gaps = 2/90 (2%) Frame = -1 Query: 332 SRVAVT--LVNCGVCA*KIIILFSFDIPTNTPSPRHKATGKGA*FLQPYLSSNWKISLDD 159 SRV +T L+ G+ ++ ++ +FD+PT + H+ G+ F + ++ N+ ++LDD Sbjct: 329 SRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHR-IGRSGRFGRKGVAINF-VTLDD 386 Query: 158 KFCSAIILRNFYDMVRYYCACVVVSM*PSN 69 + R +D+ ++Y VVV PSN Sbjct: 387 Q-------RMLFDIQKFY--NVVVEELPSN 407 >At3g03990.1 68416.m00420 esterase/lipase/thioesterase family protein low similarity to 3-oxoadipate enol-lactone hydrolase [Pseudomonas sp. B13] GI:17736948, esterase V [Pseudomonas sp.] GI:402521; contains Interpro entry IPR000379 Length = 267 Score = 27.5 bits (58), Expect = 5.7 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 197 PYLSSNWKISLDDKFCSAIILRNFYDMVRY 108 PY + N+++ L D C+ + +++D RY Sbjct: 40 PYFTQNYRVVLYDLVCAGSVNPDYFDFNRY 69 >At2g26490.1 68415.m03178 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); related to En/Spm transposon family of maize Length = 465 Score = 27.5 bits (58), Expect = 5.7 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 127 KFRKIM-AEQNLSSKEIFQLEDKYGCRNYAPLPVALCRGEGVFVGMSKEKSIMI 285 K+ +M ++ NLSS Q E++YG RN + V G G++ MS E S M+ Sbjct: 12 KYANMMHSDPNLSSTMTQQTEEEYGIRNSSASAV----GTGMYDRMSCEGSPMM 61 >At5g43310.1 68418.m05293 COP1-interacting protein-related contains similarity to COP1-Interacting Protein 7 (CIP7) [Arabidopsis thaliana] GI:3327868 Length = 1237 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/62 (25%), Positives = 31/62 (50%) Frame = +3 Query: 243 RSVRWDVEGKKYYDFLSAYSAVNQGHCHPRIIEALKKQADNLTLVSRAFYSDQLGKYEKY 422 RS+ D + D +S S + +G I+E +++ ++L LV SD + + K+ Sbjct: 1019 RSISRDQVKNEKSDVVSENSTIREGVDKEGIVETMQECGNDLVLVRLETLSDLVTETPKF 1078 Query: 423 MT 428 +T Sbjct: 1079 LT 1080 >At3g59290.1 68416.m06609 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein - Avena fatua, EMBL:U80041 Length = 1024 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 315 GHCHPRIIEALKKQADNLTLVSRAFYSDQLGK 410 GH R+IE +K+ A +T +S Y D GK Sbjct: 92 GHGSERVIEEVKEHAYQITTLSGFQYIDSSGK 123 >At3g22200.1 68416.m02801 4-aminobutyrate aminotransferase / gamma-amino-N-butyrate transaminase / GABA transaminase / beta-alanine--oxoglutarate aminotransferase identical to gamma-aminobutyrate transaminase subunit precursor [Arabidopsis thaliana] (EC 2.6.1.19) GI:14030435; contains Pfam profile PF00202: aminotransferase, class III; identical to cDNA gamma-aminobutyrate transaminase subunit precursor, nuclear gene for mitochondrial product GI:14030434 Length = 504 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 255 WDVEGKKYYDFLSAYSAVNQGHCHPRIIEALKKQADNL 368 +D GKKY D L+ G PR++ A +Q + L Sbjct: 82 YDDTGKKYLDSLAGLWCTALGGNEPRLVSAAVEQLNTL 119 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,507,858 Number of Sequences: 28952 Number of extensions: 237962 Number of successful extensions: 510 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -