BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20311 (589 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U32305-15|AAK18858.4| 567|Caenorhabditis elegans Hypothetical p... 28 5.7 >U32305-15|AAK18858.4| 567|Caenorhabditis elegans Hypothetical protein B0336.11a protein. Length = 567 Score = 27.9 bits (59), Expect = 5.7 Identities = 35/156 (22%), Positives = 55/156 (35%), Gaps = 3/156 (1%) Frame = +3 Query: 66 LLSYKKTLVEVESLVIGNHNYTLSYVYSYIEKYQGLFNTLNRIITTIKERRLM---GCQI 236 LLS K L + G ++ + KY+ + ++ T ER M GCQ Sbjct: 94 LLSLKPLLDNQLMYLHGKDLQNRHMLWIMMNKYKNGDDGFEKLFTFWIERHYMEYKGCQP 153 Query: 237 LSLIHQIF*VATSRFMMPF*KYLQV*TKYSYINYVLGFFMGN*RMCIKSSSYQKEKMTRQ 416 L++ + K++ +KY Y N + + + +S Sbjct: 154 LTVFIDMTGTGLKNMSFDAMKFIIHSSKYYYPNSIESILIFENPAILNASWKVIGSWLES 213 Query: 417 KLYCQHHLLLMSVTKLLFLHCRRH*VVVTHSSNTDT 524 Q H LL VTKL H ++ H TDT Sbjct: 214 SAASQRHDLLTFVTKLSVTHYVPKSHLLEHQGGTDT 249 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,122,181 Number of Sequences: 27780 Number of extensions: 261604 Number of successful extensions: 615 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1237082886 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -