BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20309 (727 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0438 - 17737040-17737122,17737373-17737496,17737897-177381... 29 3.8 02_02_0093 + 6692957-6693536,6693671-6694077,6694198-6694785 29 5.0 >11_04_0438 - 17737040-17737122,17737373-17737496,17737897-17738182, 17738265-17738397,17738742-17738953,17739455-17739816, 17739907-17739937,17744738-17745111 Length = 534 Score = 29.1 bits (62), Expect = 3.8 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = +2 Query: 29 PLPYRARPREAGNSTHTKRNTFGLKV*IPGH---KIQKKKRNVYYYTA 163 P + RP AG+S +R+ G+ + IPG +IQ + RN+ Y + Sbjct: 103 PSSRQIRPTMAGSSRVGRRSAAGMPIKIPGDSKIEIQNRSRNLTVYAS 150 >02_02_0093 + 6692957-6693536,6693671-6694077,6694198-6694785 Length = 524 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 584 EAWQPVYGMVWTRVWESLLLHRDEVVLSHFKSIISSPLSIV 706 + WQ +G W+RV + + +LS + I SSP S+V Sbjct: 480 DGWQRHFGAKWSRVADLKAKYDPHRILSPGQRIFSSPASMV 520 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,799,739 Number of Sequences: 37544 Number of extensions: 453659 Number of successful extensions: 976 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 975 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -