BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20309 (727 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 1.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 1.8 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 25 1.8 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 25 1.8 AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease pr... 23 9.6 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 110 IPGHKIQKKKRNVYYYTAYRRGRYEYM 190 + +KI + ++YT +RR R EY+ Sbjct: 2412 VQSYKIDANGNHQHFYTGFRRYRLEYV 2438 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 110 IPGHKIQKKKRNVYYYTAYRRGRYEYM 190 + +KI + ++YT +RR R EY+ Sbjct: 2413 VQSYKIDANGNHQHFYTGFRRYRLEYV 2439 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -2 Query: 663 RTTSSRCNSNDSHTRVHTIPYTGCHASVCRLSTCGG 556 R SS C+ +V+ + Y G + + S CGG Sbjct: 289 RKPSSTCSKASGTGQVYNLSYPGYKSRMSSCSRCGG 324 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +2 Query: 569 LRRHTEAWQPVYGMVWTRVWESLLLHRD 652 +R+ + VYG ++ +V E +L H+D Sbjct: 247 MRKRIDHHSKVYGTMYAKVTECVLFHKD 274 >AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease protein. Length = 355 Score = 23.0 bits (47), Expect = 9.6 Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 2/19 (10%) Frame = +1 Query: 19 RYI--ASPIPRPAPRGWQL 69 RYI A+ +P PRGWQL Sbjct: 141 RYILTAAHCIQPLPRGWQL 159 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 831,667 Number of Sequences: 2352 Number of extensions: 18683 Number of successful extensions: 38 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -