BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20309 (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.8 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 21 9.0 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 21 9.0 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 6.8 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +3 Query: 24 YRLSHTAPGPARLATLLIRNETRLA*RSRYQAIKSKKKSET 146 Y+ PG R + LL N R YQ I + + +T Sbjct: 368 YKDGRQLPGTGRQSELLRLNGINREDRGMYQCIVRRSEGDT 408 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 6.8 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +3 Query: 24 YRLSHTAPGPARLATLLIRNETRLA*RSRYQAIKSKKKSET 146 Y+ PG R + LL N R YQ I + + +T Sbjct: 368 YKDGRQLPGTGRQSELLRLNGINREDRGMYQCIVRRSEGDT 408 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 72 VELPASRGRARYGRGDIAN 16 V +P +G Y RG++AN Sbjct: 61 VRIPKEQGFLSYWRGNLAN 79 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 72 VELPASRGRARYGRGDIAN 16 V +P +G Y RG++AN Sbjct: 61 VRIPKEQGFLSYWRGNLAN 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 228,800 Number of Sequences: 438 Number of extensions: 5514 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -