SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20302
         (444 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    23   1.5  
DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    21   8.0  

>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 23.0 bits (47), Expect = 1.5
 Identities = 9/13 (69%), Positives = 12/13 (92%)
 Frame = +3

Query: 12  TYIIILTTVLPTT 50
           TYIIIL T++P+T
Sbjct: 419 TYIIILITLVPST 431


>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 20.6 bits (41), Expect = 8.0
 Identities = 10/31 (32%), Positives = 14/31 (45%)
 Frame = +1

Query: 55  PRISEPELKSSRPFLENFKFSQTTYNTYCIQ 147
           P I  P+L  S  +  +     +T N  CIQ
Sbjct: 174 PEIELPQLDISNNYTTDCTIEYSTGNFTCIQ 204


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,996
Number of Sequences: 438
Number of extensions: 2865
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11574126
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -