BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20302 (444 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 1.5 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 8.0 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.0 bits (47), Expect = 1.5 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +3 Query: 12 TYIIILTTVLPTT 50 TYIIIL T++P+T Sbjct: 419 TYIIILITLVPST 431 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 20.6 bits (41), Expect = 8.0 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 55 PRISEPELKSSRPFLENFKFSQTTYNTYCIQ 147 P I P+L S + + +T N CIQ Sbjct: 174 PEIELPQLDISNNYTTDCTIEYSTGNFTCIQ 204 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,996 Number of Sequences: 438 Number of extensions: 2865 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -