BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20300 (689 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.63 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.63 SPBC12C2.12c |glo1|SPBC21D10.03c|glyoxalase I |Schizosaccharomyc... 27 3.4 SPAP7G5.04c |lys1||aminoadipate-semialdehyde dehydrogenase |Schi... 26 4.5 SPAC23C4.12 |hhp2||serine/threonine protein kinase Hhp2 |Schizos... 26 5.9 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 25 7.8 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.1 bits (62), Expect = 0.63 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 5 SGCGRCRVWSMFVRYVRFSE 64 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.63 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 189 ARKIRGRPENAGPDPVRNVRRFSRV 115 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPBC12C2.12c |glo1|SPBC21D10.03c|glyoxalase I |Schizosaccharomyces pombe|chr 2|||Manual Length = 302 Score = 26.6 bits (56), Expect = 3.4 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +3 Query: 432 SQMPRH----LISDAHEWINEIPTVPIYYLRNHSQGNGLGRI 545 S +PRH L+ H W E + P+Y+ N G G + Sbjct: 211 SDLPRHDREGLLELTHNWGTEKESGPVYHNGNDGDEKGYGHV 252 >SPAP7G5.04c |lys1||aminoadipate-semialdehyde dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1419 Score = 26.2 bits (55), Expect = 4.5 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 6/44 (13%) Frame = -1 Query: 608 PLMSPYNARLE------SSSTGSSFPADSPKPVPLAVVSQIVDR 495 P + YN RLE S T S P D +PVP +V + +R Sbjct: 6 PSDTEYNQRLERWSERLKSQTISHLPTDYSRPVPSRLVEAVFER 49 >SPAC23C4.12 |hhp2||serine/threonine protein kinase Hhp2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 400 Score = 25.8 bits (54), Expect = 5.9 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -1 Query: 626 SPTYAT-PLMSPYNARLESSSTGSSFPADSPKPVPLAVVSQIVDRD 492 +P Y++ PL + N + S + + SP P+PL+ S + ++D Sbjct: 329 TPNYSSIPLPAERNPKTPQSFSTNIVQCASPSPLPLSFRSPVPNKD 374 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.4 bits (53), Expect = 7.8 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -3 Query: 435 GYLKRVIVTPAVYPRLLEFLHVDIQST 355 G+++R+ V YP LLE+L++ + S+ Sbjct: 76 GFIERISVILRDYPDLLEYLNIFLPSS 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,824,027 Number of Sequences: 5004 Number of extensions: 56426 Number of successful extensions: 143 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -