BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20298 (560 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19050| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_25939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_19050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 28.3 bits (60), Expect = 4.5 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -1 Query: 293 TLIYFTIFNYFNISFMIRHRFNISNIEYILLLNV--FLSAAIMI 168 T++ + +F + + +RHR SN+ Y LLL V AAI I Sbjct: 118 TIVAIALDRFFAVCYPLRHRVTSSNV-YFLLLGVLWLFPAAIAI 160 >SB_25939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/44 (27%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +1 Query: 406 DIFDT--IIRSYPWIVLTSVIANCMQPIQAAFLKNLERRKTGIC 531 D++D I S+P + +V A C+Q + A + N+ + + +C Sbjct: 160 DVYDLSLTITSFPSVCYANVSATCLQSLAAEAILNMVQAQGDVC 203 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,157,861 Number of Sequences: 59808 Number of extensions: 270730 Number of successful extensions: 729 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -