BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20298 (560 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011441-1|AAR99099.1| 525|Drosophila melanogaster RE55714p pro... 29 4.3 AE014297-886|AAF54342.1| 1342|Drosophila melanogaster CG9746-PA ... 29 4.3 >BT011441-1|AAR99099.1| 525|Drosophila melanogaster RE55714p protein. Length = 525 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/34 (32%), Positives = 23/34 (67%) Frame = +1 Query: 352 LLFAINRCNKQFLVSNESDIFDTIIRSYPWIVLT 453 +L A+N+C+KQ + + + + +I S+ WI+L+ Sbjct: 134 ILCALNQCHKQKICHGDIKLENILITSWNWILLS 167 >AE014297-886|AAF54342.1| 1342|Drosophila melanogaster CG9746-PA protein. Length = 1342 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/34 (32%), Positives = 23/34 (67%) Frame = +1 Query: 352 LLFAINRCNKQFLVSNESDIFDTIIRSYPWIVLT 453 +L A+N+C+KQ + + + + +I S+ WI+L+ Sbjct: 134 ILCALNQCHKQKICHGDIKLENILITSWNWILLS 167 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,848,041 Number of Sequences: 53049 Number of extensions: 393433 Number of successful extensions: 726 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2172596895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -