BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20298 (560 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 3.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 3.7 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 22 3.7 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 4.9 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 4.9 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 6.4 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 6.4 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 3.7 Identities = 6/20 (30%), Positives = 14/20 (70%) Frame = +1 Query: 64 LFVSIICDIEYVLYTCCYSD 123 LF++I+C + Y++ C ++ Sbjct: 417 LFIAIVCFVSYLIGLFCITE 436 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 3.7 Identities = 6/20 (30%), Positives = 14/20 (70%) Frame = +1 Query: 64 LFVSIICDIEYVLYTCCYSD 123 LF++I+C + Y++ C ++ Sbjct: 470 LFIAIVCFVSYLIGLFCITE 489 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -3 Query: 129 DFVAITTRI*YVFYITYYRDKQLPANDSEPPVGNAFNIA 13 DF+ + V ++ Y DK +PA+ P N +I+ Sbjct: 137 DFIQKNLQCCGVHSLSDYNDKPIPASCCNSPENNTCSIS 175 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -1 Query: 113 QHVYSTYSISHIIETNNYLLMIPNRQLGTLSTSPVN 6 QH + S+ +I NNY + P + + P N Sbjct: 128 QHEWFQLSLKNIEPYNNYYIWHPGKIVNGKRVPPTN 163 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -1 Query: 113 QHVYSTYSISHIIETNNYLLMIPNRQLGTLSTSPVN 6 QH + S+ +I NNY + P + + P N Sbjct: 128 QHEWFQLSLKNIEPYNNYYIWHPGKIVNGKRVPPTN 163 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 6.4 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +1 Query: 172 IMAAERKTFNNKMYSMFDMLNRCLI 246 ++ + N K Y M+D+L R ++ Sbjct: 367 VIEGNSDSINTKFYGMYDILARDIL 391 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 6.4 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +1 Query: 172 IMAAERKTFNNKMYSMFDMLNRCLI 246 ++ + N K Y M+D+L R ++ Sbjct: 367 VIEGSSDSINTKFYGMYDILARDIL 391 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,518 Number of Sequences: 438 Number of extensions: 3295 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -