BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20295 (570 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28123| Best HMM Match : zf-NF-X1 (HMM E-Value=0.24) 29 2.0 SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_17366| Best HMM Match : Filament (HMM E-Value=0.14) 28 6.2 >SB_28123| Best HMM Match : zf-NF-X1 (HMM E-Value=0.24) Length = 453 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +1 Query: 193 KKSEVITNVVNKLIRNNKMN*WSTPINFGSRAPRTSSGIVSQLSSD 330 K+ ++TN+ + I N++N + INF R S + +++SSD Sbjct: 214 KEKMILTNLKSPRITANQLNVYKNQINFLKRMFELQSALEAEVSSD 259 >SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 588 Score = 27.9 bits (59), Expect = 6.2 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +2 Query: 86 QIPTSLTTFWRSSFTIASSSPITTVRLKRASIYTRRRRAKSSQM 217 +IPTS R SFTI P + VR R S +T RR +S++ Sbjct: 403 RIPTSRVRQTRLSFTIVRRIPTSRVRQTRLS-FTMIRRIPASRV 445 >SB_17366| Best HMM Match : Filament (HMM E-Value=0.14) Length = 306 Score = 27.9 bits (59), Expect = 6.2 Identities = 27/111 (24%), Positives = 45/111 (40%), Gaps = 7/111 (6%) Frame = +1 Query: 73 SLYAADSDVPNDILEEQLYNSVVVADYDSAVEKS---KHLYEEKKSEVITNVVN-KLIRN 240 +L D D + E +++ +S +E + K+ + E+ +N KLI Sbjct: 22 NLLEHDKDAMESTMSELREEVILLRKENSQIESTFVEKNAELRQHFEIEKEELNRKLIHE 81 Query: 241 NKMN*WSTPINFGSR---APRTSSGIVSQLSSDLSSPKTRLSLCTSATVSL 384 + +S F + T SG++ QL DL KTR SA + L Sbjct: 82 KEELRYSLEAEFSQKFVNESATQSGVIQQLDGDLRMMKTRCGELESAMLEL 132 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,100,674 Number of Sequences: 59808 Number of extensions: 305631 Number of successful extensions: 902 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -