BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20295 (570 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY121690-1|AAM52017.1| 724|Drosophila melanogaster RE53177p pro... 29 5.8 AF145652-1|AAD38627.1| 499|Drosophila melanogaster BcDNA.GH0878... 29 5.8 AE014298-2880|AAF48977.2| 713|Drosophila melanogaster CG14205-P... 29 5.8 AE013599-801|AAF58981.2| 499|Drosophila melanogaster CG18659-PB... 29 5.8 AE013599-800|AAM68810.2| 908|Drosophila melanogaster CG18659-PA... 29 5.8 >AY121690-1|AAM52017.1| 724|Drosophila melanogaster RE53177p protein. Length = 724 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 43 AIVILCLFVASLYAADSDVPNDILEEQLY 129 A++ CLF YAAD+++P I+EE Y Sbjct: 553 ALLFSCLFAVYGYAADAEIP-PIVEEAFY 580 >AF145652-1|AAD38627.1| 499|Drosophila melanogaster BcDNA.GH08789 protein. Length = 499 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 452 KPESQLEVNRSVGEQQGLLKILNTERNQYLVLGVG-TNW 565 KP+ E+ R G Q L TE++Q L G G NW Sbjct: 457 KPDDDFELLRKYGLDQFTLNANGTEKSQQLTTGKGMNNW 495 >AE014298-2880|AAF48977.2| 713|Drosophila melanogaster CG14205-PA protein. Length = 713 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 43 AIVILCLFVASLYAADSDVPNDILEEQLY 129 A++ CLF YAAD+++P I+EE Y Sbjct: 542 ALLFSCLFAVYGYAADAEIP-PIVEEAFY 569 >AE013599-801|AAF58981.2| 499|Drosophila melanogaster CG18659-PB, isoform B protein. Length = 499 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 452 KPESQLEVNRSVGEQQGLLKILNTERNQYLVLGVG-TNW 565 KP+ E+ R G Q L TE++Q L G G NW Sbjct: 457 KPDDDFELLRKYGLDQFTLNANGTEKSQQLTTGKGMNNW 495 >AE013599-800|AAM68810.2| 908|Drosophila melanogaster CG18659-PA, isoform A protein. Length = 908 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 452 KPESQLEVNRSVGEQQGLLKILNTERNQYLVLGVG-TNW 565 KP+ E+ R G Q L TE++Q L G G NW Sbjct: 866 KPDDDFELLRKYGLDQFTLNANGTEKSQQLTTGKGMNNW 904 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,263,765 Number of Sequences: 53049 Number of extensions: 433022 Number of successful extensions: 1598 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1598 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2234671092 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -