BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20294 (406 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 23 0.86 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 23 1.5 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 23 1.5 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 23 1.5 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 4.6 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 6.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 20 8.0 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 20 8.0 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 23.4 bits (48), Expect = 0.86 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +1 Query: 172 GPPPQDRPGWRRAVRSSRSQLNVTQTTSVGFMPE 273 G P D P W+ + +++ + +VG PE Sbjct: 465 GSPNVDEPDWKPISKEEIHFIDIGENITVGVNPE 498 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 22.6 bits (46), Expect = 1.5 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +1 Query: 172 GPPPQDRPGWRRAVRSSRSQLNVTQTTSVGFMPE 273 G P D P W+ + +++ + +VG PE Sbjct: 463 GSPNVDGPDWKPISKEEIHFIDIGENITVGVNPE 496 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 22.6 bits (46), Expect = 1.5 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +1 Query: 172 GPPPQDRPGWRRAVRSSRSQLNVTQTTSVGFMPE 273 G P D P W+ + +++ + +VG PE Sbjct: 463 GSPNVDGPDWKPISKEEIHFIDIGENITVGVNPE 496 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 22.6 bits (46), Expect = 1.5 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +1 Query: 172 GPPPQDRPGWRRAVRSSRSQLNVTQTTSVGFMPE 273 G P D P W+ + +++ + +VG PE Sbjct: 465 GSPNVDGPDWKPISKEEIHFIDIGENITVGVNPE 498 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.0 bits (42), Expect = 4.6 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 172 GPPPQDRPGWRRAVRSSRSQLNV 240 G PPQ+ P W +S+ NV Sbjct: 11 GAPPQEMPTWFVRWLNSQQPRNV 33 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 20.6 bits (41), Expect = 6.1 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +1 Query: 148 CSFVSHWFGPPPQDRP 195 C+ S W G PP+ P Sbjct: 31 CTTASSWPGRPPKRAP 46 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.2 bits (40), Expect = 8.0 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +3 Query: 225 ESAECHTDDECWIYARDAPSLPNQ 296 E+ ECH D + P +P++ Sbjct: 2280 ENTECHPDASSTMAPSTTPMVPDK 2303 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 20.2 bits (40), Expect = 8.0 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -2 Query: 207 PAPTRAVLRWRSEPVRYKGTAPSKTLSSSIKRTVTP 100 P PT + PV T+P+ L+ +I P Sbjct: 313 PTPTSVMTELYPSPVPGHSTSPNLPLTHNIAHNPYP 348 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,782 Number of Sequences: 336 Number of extensions: 1718 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8752267 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -